Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 42974..43632 | Replicon | plasmid pIV_RAB94 |
Accession | NZ_CP121564 | ||
Organism | Acinetobacter baumannii strain RAB94 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | MTS31_RS19305 | Protein ID | WP_000312250.1 |
Coordinates | 42974..43333 (+) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | MTS31_RS19310 | Protein ID | WP_001096429.1 |
Coordinates | 43333..43632 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MTS31_RS19275 (MTS31_19275) | 38495..38809 | - | 315 | WP_000708714.1 | hypothetical protein | - |
MTS31_RS19280 (MTS31_19280) | 39864..40622 | - | 759 | WP_001053127.1 | hypothetical protein | - |
MTS31_RS19285 (MTS31_19285) | 40689..41072 | - | 384 | WP_000654348.1 | hypothetical protein | - |
MTS31_RS19290 (MTS31_19290) | 41211..41909 | - | 699 | WP_000873188.1 | hypothetical protein | - |
MTS31_RS19295 (MTS31_19295) | 41976..42158 | - | 183 | WP_000373385.1 | hypothetical protein | - |
MTS31_RS19300 (MTS31_19300) | 42207..42773 | - | 567 | WP_000710385.1 | hypothetical protein | - |
MTS31_RS19305 (MTS31_19305) | 42974..43333 | + | 360 | WP_000312250.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MTS31_RS19310 (MTS31_19310) | 43333..43632 | + | 300 | WP_001096429.1 | XRE family transcriptional regulator | Antitoxin |
MTS31_RS19315 (MTS31_19315) | 44170..44706 | - | 537 | WP_000731978.1 | hypothetical protein | - |
MTS31_RS19320 (MTS31_19320) | 44756..45310 | - | 555 | WP_000790084.1 | hypothetical protein | - |
MTS31_RS19325 (MTS31_19325) | 45330..45548 | - | 219 | WP_001043201.1 | hypothetical protein | - |
MTS31_RS19330 (MTS31_19330) | 45588..46217 | - | 630 | WP_000701003.1 | hypothetical protein | - |
MTS31_RS19335 (MTS31_19335) | 46234..46413 | - | 180 | WP_000387630.1 | hypothetical protein | - |
MTS31_RS19340 (MTS31_19340) | 46389..46961 | - | 573 | WP_000443897.1 | hypothetical protein | - |
MTS31_RS19345 (MTS31_19345) | 46966..47223 | - | 258 | WP_000834290.1 | hypothetical protein | - |
MTS31_RS19350 (MTS31_19350) | 47328..48608 | - | 1281 | WP_001093570.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aph(3')-VIa | - | 1..70111 | 70111 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13751.62 Da Isoelectric Point: 4.8212
>T276420 WP_000312250.1 NZ_CP121564:42974-43333 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|