Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 35863..36521 | Replicon | plasmid pIV_RAB97 |
Accession | NZ_CP121561 | ||
Organism | Acinetobacter baumannii strain RAB97 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | MTS88_RS19850 | Protein ID | WP_000312250.1 |
Coordinates | 35863..36222 (+) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | MTS88_RS19855 | Protein ID | WP_001096429.1 |
Coordinates | 36222..36521 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MTS88_RS19820 (MTS88_19820) | 31384..31698 | - | 315 | WP_000708714.1 | hypothetical protein | - |
MTS88_RS19825 (MTS88_19825) | 32753..33511 | - | 759 | WP_001053127.1 | hypothetical protein | - |
MTS88_RS19830 (MTS88_19830) | 33578..33961 | - | 384 | WP_000654348.1 | hypothetical protein | - |
MTS88_RS19835 (MTS88_19835) | 34100..34798 | - | 699 | WP_000873188.1 | hypothetical protein | - |
MTS88_RS19840 (MTS88_19840) | 34865..35047 | - | 183 | WP_000373385.1 | hypothetical protein | - |
MTS88_RS19845 (MTS88_19845) | 35096..35662 | - | 567 | WP_000710385.1 | hypothetical protein | - |
MTS88_RS19850 (MTS88_19850) | 35863..36222 | + | 360 | WP_000312250.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MTS88_RS19855 (MTS88_19855) | 36222..36521 | + | 300 | WP_001096429.1 | XRE family transcriptional regulator | Antitoxin |
MTS88_RS19860 (MTS88_19860) | 37059..37595 | - | 537 | WP_000731978.1 | hypothetical protein | - |
MTS88_RS19865 (MTS88_19865) | 37645..38199 | - | 555 | WP_000790084.1 | hypothetical protein | - |
MTS88_RS19870 (MTS88_19870) | 38219..38437 | - | 219 | WP_001043201.1 | hypothetical protein | - |
MTS88_RS19875 (MTS88_19875) | 38477..39106 | - | 630 | WP_000701003.1 | hypothetical protein | - |
MTS88_RS19880 (MTS88_19880) | 39123..39302 | - | 180 | WP_000387630.1 | hypothetical protein | - |
MTS88_RS19885 (MTS88_19885) | 39278..39850 | - | 573 | WP_000443897.1 | hypothetical protein | - |
MTS88_RS19890 (MTS88_19890) | 39855..40112 | - | 258 | WP_000834290.1 | hypothetical protein | - |
MTS88_RS19895 (MTS88_19895) | 40217..41497 | - | 1281 | WP_001093570.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..68813 | 68813 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13751.62 Da Isoelectric Point: 4.8212
>T276416 WP_000312250.1 NZ_CP121561:35863-36222 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|