Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 2374239..2375041 | Replicon | chromosome |
Accession | NZ_CP121518 | ||
Organism | Staphylococcus epidermidis strain 6DSE07 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | Q5HN83 |
Locus tag | QA594_RS11235 | Protein ID | WP_002468490.1 |
Coordinates | 2374239..2374418 (-) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | Q5HN82 |
Locus tag | QA594_RS11240 | Protein ID | WP_002456349.1 |
Coordinates | 2374442..2375041 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA594_RS11215 | 2369632..2370765 | - | 1134 | WP_001829819.1 | GAF domain-containing sensor histidine kinase | - |
QA594_RS11220 | 2370924..2371748 | + | 825 | WP_001829804.1 | RluA family pseudouridine synthase | - |
QA594_RS11225 | 2372109..2373494 | - | 1386 | WP_001829862.1 | class II fumarate hydratase | - |
QA594_RS11230 | 2373679..2374083 | - | 405 | WP_001829818.1 | hypothetical protein | - |
QA594_RS11235 | 2374239..2374418 | - | 180 | WP_002468490.1 | SAS053 family protein | Toxin |
QA594_RS11240 | 2374442..2375041 | - | 600 | WP_002456349.1 | glucosamine-6-phosphate isomerase | Antitoxin |
QA594_RS11245 | 2375199..2375669 | - | 471 | WP_001829836.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
QA594_RS11250 | 2375666..2376796 | - | 1131 | WP_001829814.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
QA594_RS11255 | 2377005..2377142 | - | 138 | WP_064783702.1 | hypothetical protein | - |
QA594_RS11260 | 2377657..2378379 | - | 723 | WP_001829838.1 | amino acid ABC transporter ATP-binding protein | - |
QA594_RS11265 | 2378372..2379829 | - | 1458 | WP_070501559.1 | ABC transporter substrate-binding protein/permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 2377005..2377160 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6963.56 Da Isoelectric Point: 4.3016
>T276395 WP_002468490.1 NZ_CP121518:c2374418-2374239 [Staphylococcus epidermidis]
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDLKKQ
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDLKKQ
Download Length: 180 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22709.62 Da Isoelectric Point: 4.9942
>AT276395 WP_002456349.1 NZ_CP121518:c2375041-2374442 [Staphylococcus epidermidis]
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEHAPVFDELKKNVENHTVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGKLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEHAPVFDELKKNVENHTVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGKLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G7HY44 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5E9LUD0 |