Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/Fst(toxin) |
Location | 7416..7576 | Replicon | plasmid unnamed2 |
Accession | NZ_CP121488 | ||
Organism | Staphylococcus epidermidis strain 32FSE02 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | QA591_RS11820 | Protein ID | WP_152901349.1 |
Coordinates | 7481..7576 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 7416..7453 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA591_RS11815 (6420) | 6420..7022 | - | 603 | WP_049366465.1 | recombinase family protein | - |
- (7416) | 7416..7453 | + | 38 | NuclAT_0 | - | Antitoxin |
- (7416) | 7416..7453 | + | 38 | NuclAT_0 | - | Antitoxin |
QA591_RS11820 (7481) | 7481..7576 | - | 96 | WP_152901349.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
QA591_RS11825 (7941) | 7941..9194 | - | 1254 | WP_080351652.1 | replication initiator protein A | - |
QA591_RS11830 (9830) | 9830..10624 | + | 795 | WP_049366491.1 | ParA family protein | - |
QA591_RS11835 (10630) | 10630..10830 | + | 201 | WP_002485209.1 | hypothetical protein | - |
QA591_RS11840 (11052) | 11052..11881 | - | 830 | Protein_7 | RepB family plasmid replication initiator protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3587.36 Da Isoelectric Point: 9.9256
>T276370 WP_152901349.1 NZ_CP121488:c7576-7481 [Staphylococcus epidermidis]
MLMIFVHIIAPVISGCAVAYFTYWLNSKRNK
MLMIFVHIIAPVISGCAVAYFTYWLNSKRNK
Download Length: 96 bp
Antitoxin
Download Length: 38 bp
>AT276370 NZ_CP121488:7416-7453 [Staphylococcus epidermidis]
TATGCACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
TATGCACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|