Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 4816122..4816726 | Replicon | chromosome |
Accession | NZ_CP121476 | ||
Organism | Pseudomonas sp. 905_Psudmo1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | P9K38_RS22615 | Protein ID | WP_021488744.1 |
Coordinates | 4816412..4816726 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A328VUT6 |
Locus tag | P9K38_RS22610 | Protein ID | WP_021488745.1 |
Coordinates | 4816122..4816412 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9K38_RS22590 (P9K38_22590) | 4811625..4812488 | - | 864 | WP_010466255.1 | phosphate/phosphite/phosphonate ABC transporter substrate-binding protein | - |
P9K38_RS22595 (P9K38_22595) | 4812485..4813312 | - | 828 | WP_003118432.1 | phosphonate ABC transporter ATP-binding protein | - |
P9K38_RS22600 (P9K38_22600) | 4813637..4813810 | - | 174 | WP_230927756.1 | AlpA family phage regulatory protein | - |
P9K38_RS22605 (P9K38_22605) | 4814062..4815525 | - | 1464 | WP_021488746.1 | hypothetical protein | - |
P9K38_RS22610 (P9K38_22610) | 4816122..4816412 | - | 291 | WP_021488745.1 | helix-turn-helix domain-containing protein | Antitoxin |
P9K38_RS22615 (P9K38_22615) | 4816412..4816726 | - | 315 | WP_021488744.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P9K38_RS22620 (P9K38_22620) | 4817256..4818026 | + | 771 | WP_021488743.1 | NERD domain-containing protein | - |
P9K38_RS22625 (P9K38_22625) | 4818101..4819519 | + | 1419 | WP_021488742.1 | hypothetical protein | - |
P9K38_RS22630 (P9K38_22630) | 4819663..4820304 | + | 642 | WP_278325558.1 | GIY-YIG nuclease family protein | - |
P9K38_RS22635 (P9K38_22635) | 4820404..4820670 | - | 267 | WP_021490327.1 | helix-turn-helix transcriptional regulator | - |
P9K38_RS22640 (P9K38_22640) | 4820766..4821293 | + | 528 | WP_021490328.1 | Bro-N domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11888.76 Da Isoelectric Point: 9.7334
>T276354 WP_021488744.1 NZ_CP121476:c4816726-4816412 [Pseudomonas sp. 905_Psudmo1]
MIFIETPIFTEDVKELLSEDEYREFQQYLADNPLAGRVITETGGLRKVRWGSAGRGKSGGVRVIYFHVVGASQIRLVMIY
QKGIKDDLSKDEKKALRKIIEGWK
MIFIETPIFTEDVKELLSEDEYREFQQYLADNPLAGRVITETGGLRKVRWGSAGRGKSGGVRVIYFHVVGASQIRLVMIY
QKGIKDDLSKDEKKALRKIIEGWK
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|