Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2621836..2622406 | Replicon | chromosome |
Accession | NZ_CP121463 | ||
Organism | Arthrobacter sp. Y-9 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | P9849_RS11795 | Protein ID | WP_278266971.1 |
Coordinates | 2622125..2622406 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | P9849_RS11790 | Protein ID | WP_278266970.1 |
Coordinates | 2621836..2622138 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9849_RS11770 (P9849_11770) | 2617676..2618911 | - | 1236 | WP_278266966.1 | alpha/beta fold hydrolase | - |
P9849_RS11775 (P9849_11775) | 2618977..2619915 | - | 939 | WP_278266967.1 | DMT family transporter | - |
P9849_RS11780 (P9849_11780) | 2619988..2620893 | + | 906 | WP_278266968.1 | LysR family transcriptional regulator | - |
P9849_RS11785 (P9849_11785) | 2620972..2621802 | + | 831 | WP_278266969.1 | oxidoreductase | - |
P9849_RS11790 (P9849_11790) | 2621836..2622138 | - | 303 | WP_278266970.1 | HigA family addiction module antitoxin | Antitoxin |
P9849_RS11795 (P9849_11795) | 2622125..2622406 | - | 282 | WP_278266971.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P9849_RS11800 (P9849_11800) | 2622679..2623215 | - | 537 | WP_278266972.1 | hypothetical protein | - |
P9849_RS11805 (P9849_11805) | 2623278..2624006 | - | 729 | WP_278266973.1 | hypothetical protein | - |
P9849_RS11810 (P9849_11810) | 2624191..2625054 | - | 864 | WP_278266974.1 | AraC family transcriptional regulator | - |
P9849_RS11815 (P9849_11815) | 2625302..2625640 | - | 339 | WP_278266975.1 | DUF86 domain-containing protein | - |
P9849_RS11820 (P9849_11820) | 2625637..2626080 | - | 444 | WP_278266976.1 | helix-turn-helix domain-containing protein | - |
P9849_RS11825 (P9849_11825) | 2626164..2626613 | - | 450 | WP_278266977.1 | NUDIX domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10766.23 Da Isoelectric Point: 11.0062
>T276343 WP_278266971.1 NZ_CP121463:c2622406-2622125 [Arthrobacter sp. Y-9]
VIRSFRDPATGRLWRRDRVPSIDSRIHRVALRKLRQLGAAESLADLRVPPGNRLEALAGERAGQHSIRINDQWRICFRWT
DAGPEEVEIVDYH
VIRSFRDPATGRLWRRDRVPSIDSRIHRVALRKLRQLGAAESLADLRVPPGNRLEALAGERAGQHSIRINDQWRICFRWT
DAGPEEVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|