Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 27681..28332 | Replicon | plasmid plas1_LRB |
Accession | NZ_CP121371 | ||
Organism | Acinetobacter baumannii strain LRB |
Toxin (Protein)
Gene name | higB | Uniprot ID | N8YFZ1 |
Locus tag | P9J61_RS18360 | Protein ID | WP_000269904.1 |
Coordinates | 27681..28037 (+) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | P9J61_RS18365 | Protein ID | WP_024436604.1 |
Coordinates | 28030..28332 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9J61_RS18340 (P9J61_18340) | 23428..23763 | - | 336 | WP_004740263.1 | carboxymuconolactone decarboxylase family protein | - |
P9J61_RS18345 (P9J61_18345) | 23961..24068 | - | 108 | Protein_24 | transcriptional regulator | - |
P9J61_RS18350 (P9J61_18350) | 24110..24796 | - | 687 | WP_004740261.1 | DUF4145 domain-containing protein | - |
P9J61_RS18355 (P9J61_18355) | 24910..26964 | - | 2055 | WP_004740259.1 | TonB-dependent receptor | - |
P9J61_RS18360 (P9J61_18360) | 27681..28037 | + | 357 | WP_000269904.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P9J61_RS18365 (P9J61_18365) | 28030..28332 | + | 303 | WP_024436604.1 | XRE family transcriptional regulator | Antitoxin |
P9J61_RS18370 (P9J61_18370) | 28325..28534 | + | 210 | WP_000069475.1 | hypothetical protein | - |
P9J61_RS18375 (P9J61_18375) | 28709..29227 | + | 519 | WP_000447196.1 | tetratricopeptide repeat protein | - |
P9J61_RS18380 (P9J61_18380) | 29266..29778 | + | 513 | WP_024436968.1 | SMI1/KNR4 family protein | - |
P9J61_RS18385 (P9J61_18385) | 29961..30296 | + | 336 | Protein_32 | hypothetical protein | - |
P9J61_RS18390 (P9J61_18390) | 30359..31524 | + | 1166 | WP_085942227.1 | IS3-like element ISAba22 family transposase | - |
P9J61_RS18395 (P9J61_18395) | 31891..32118 | - | 228 | Protein_34 | recombinase family protein | - |
P9J61_RS18400 (P9J61_18400) | 32173..32877 | - | 705 | WP_004741406.1 | IS6-like element IS1006 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..101824 | 101824 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13488.42 Da Isoelectric Point: 5.7104
>T276333 WP_000269904.1 NZ_CP121371:27681-28037 [Acinetobacter baumannii]
MWTVITTDLFNEWLEQQDEATQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKSNKKRFYTEMLAIADEQYALHLSTLGDQSNG
MWTVITTDLFNEWLEQQDEATQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKSNKKRFYTEMLAIADEQYALHLSTLGDQSNG
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|