Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 74139..74790 | Replicon | plasmid plas1_Ab_8_4 |
| Accession | NZ_CP121366 | ||
| Organism | Acinetobacter baumannii strain Ab_8_4 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | N8YFZ1 |
| Locus tag | P9J59_RS18625 | Protein ID | WP_000269904.1 |
| Coordinates | 74434..74790 (-) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P9J59_RS18620 | Protein ID | WP_024436604.1 |
| Coordinates | 74139..74441 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P9J59_RS18585 (P9J59_18585) | 69594..70298 | + | 705 | WP_004741406.1 | IS6-like element IS1006 family transposase | - |
| P9J59_RS18590 (P9J59_18590) | 70353..70580 | + | 228 | Protein_72 | recombinase family protein | - |
| P9J59_RS18600 (P9J59_18600) | 72175..72510 | - | 336 | Protein_74 | hypothetical protein | - |
| P9J59_RS18605 (P9J59_18605) | 72693..73205 | - | 513 | WP_024436968.1 | SMI1/KNR4 family protein | - |
| P9J59_RS18610 (P9J59_18610) | 73244..73762 | - | 519 | WP_000447196.1 | tetratricopeptide repeat protein | - |
| P9J59_RS18615 (P9J59_18615) | 73937..74146 | - | 210 | WP_000069475.1 | hypothetical protein | - |
| P9J59_RS18620 (P9J59_18620) | 74139..74441 | - | 303 | WP_024436604.1 | XRE family transcriptional regulator | Antitoxin |
| P9J59_RS18625 (P9J59_18625) | 74434..74790 | - | 357 | WP_000269904.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P9J59_RS18630 (P9J59_18630) | 75507..77561 | + | 2055 | WP_004740259.1 | TonB-dependent receptor | - |
| P9J59_RS18635 (P9J59_18635) | 77675..78361 | + | 687 | WP_004740261.1 | DUF4145 domain-containing protein | - |
| P9J59_RS18640 (P9J59_18640) | 78403..78510 | + | 108 | Protein_82 | transcriptional regulator | - |
| P9J59_RS18645 (P9J59_18645) | 78708..79043 | + | 336 | WP_004740263.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..101824 | 101824 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13488.42 Da Isoelectric Point: 5.7104
>T276326 WP_000269904.1 NZ_CP121366:c74790-74434 [Acinetobacter baumannii]
MWTVITTDLFNEWLEQQDEATQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKSNKKRFYTEMLAIADEQYALHLSTLGDQSNG
MWTVITTDLFNEWLEQQDEATQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKSNKKRFYTEMLAIADEQYALHLSTLGDQSNG
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|