Detailed information of TA system TA276317

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 72752..73173
• Replicon: plasmid pVP443
• Accession: NZ_CP121360
• Organism: Escherichia coli strain rl0044

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: P9060_RS28395
• Protein ID: WP_096937776.1
• Coordinates: 72752..72877 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	72975..73173 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
P9060_RS28355 (67779)	67779..68144	-	366	WP_000338819.1	type IV conjugative transfer system pilin TraA	-
P9060_RS28360 (68188)	68188..68403	-	216	WP_071782156.1	conjugal transfer relaxosome protein TraY	-
P9060_RS28365 (68539)	68539..69186	-	648	WP_000332521.1	conjugal transfer transcriptional regulator TraJ	-
P9060_RS28370 (69377)	69377..69760	-	384	WP_001151534.1	conjugal transfer relaxosome DNA-binding protein TraM	-
P9060_RS28375 (70081)	70081..70683	+	603	WP_077632063.1	transglycosylase SLT domain-containing protein	-
P9060_RS28380 (70979)	70979..71800	-	822	WP_001424949.1	DUF932 domain-containing protein	-
P9060_RS28385 (71918)	71918..72205	-	288	WP_000107541.1	hypothetical protein	-
P9060_RS28390 (72265)	72265..72451	+	187	Protein_87	pilus protein	-
P9060_RS28395 (72752)	72752..72877	-	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
P9060_RS28400 (72819)	72819..72968	-	150	Protein_89	DUF5431 family protein	-
- (72975)	72975..73173	-	199	NuclAT_0	-	Antitoxin
- (72975)	72975..73173	-	199	NuclAT_0	-	Antitoxin
- (72975)	72975..73173	-	199	NuclAT_0	-	Antitoxin
- (72975)	72975..73173	-	199	NuclAT_0	-	Antitoxin
P9060_RS28405 (73142)	73142..73904	-	763	Protein_90	plasmid SOS inhibition protein A	-
P9060_RS28410 (73901)	73901..74335	-	435	WP_278242787.1	conjugation system SOS inhibitor PsiB	-
P9060_RS28415 (74390)	74390..76348	-	1959	WP_000117204.1	ParB/RepB/Spo0J family partition protein	-
P9060_RS28420 (76412)	76412..76645	-	234	WP_000005985.1	DUF905 family protein	-
P9060_RS28425 (76707)	76707..77246	-	540	WP_000290811.1	single-stranded DNA-binding protein	-
P9060_RS28430 (77272)	77272..77478	-	207	WP_000275848.1	hypothetical protein	-
P9060_RS28435 (77548)	77548..77974	+	427	Protein_96	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	eltA / eltB	1..93908	93908

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T276317 WP_096937776.1 NZ_CP121360:c72877-72752 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 199 bp

>AT276317 NZ_CP121360:c73173-72975 [Escherichia coli]
TCATACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC

Structures

Antitoxin