Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 4228394..4229088 | Replicon | chromosome |
Accession | NZ_CP121356 | ||
Organism | Escherichia coli strain rl0044 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | A0A3A6T3I6 |
Locus tag | P9060_RS21410 | Protein ID | WP_001263490.1 |
Coordinates | 4228394..4228792 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1FJN6 |
Locus tag | P9060_RS21415 | Protein ID | WP_000554757.1 |
Coordinates | 4228795..4229088 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (4224054) | 4224054..4224134 | - | 81 | NuclAT_9 | - | - |
- (4224054) | 4224054..4224134 | - | 81 | NuclAT_9 | - | - |
- (4224054) | 4224054..4224134 | - | 81 | NuclAT_9 | - | - |
- (4224054) | 4224054..4224134 | - | 81 | NuclAT_9 | - | - |
P9060_RS21380 (4223394) | 4223394..4224638 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
P9060_RS21385 (4224730) | 4224730..4225188 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
P9060_RS21390 (4225449) | 4225449..4226906 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
P9060_RS21395 (4226963) | 4226963..4227484 | - | 522 | Protein_4194 | peptide chain release factor H | - |
P9060_RS21400 (4227483) | 4227483..4227686 | - | 204 | Protein_4195 | RtcB family protein | - |
P9060_RS21405 (4227932) | 4227932..4228384 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
P9060_RS21410 (4228394) | 4228394..4228792 | - | 399 | WP_001263490.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
P9060_RS21415 (4228795) | 4228795..4229088 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
P9060_RS21420 (4229140) | 4229140..4230195 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
P9060_RS21425 (4230266) | 4230266..4231051 | - | 786 | WP_000207587.1 | putative lateral flagellar export/assembly protein LafU | - |
P9060_RS21430 (4231023) | 4231023..4232735 | + | 1713 | Protein_4201 | flagellar biosynthesis protein FlhA | - |
P9060_RS21435 (4232959) | 4232959..4233456 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4205387..4234258 | 28871 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15486.86 Da Isoelectric Point: 8.0949
>T276310 WP_001263490.1 NZ_CP121356:c4228792-4228394 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLLYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLLYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3A6T3I6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1FJN6 |