Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1178073..1178685 | Replicon | chromosome |
Accession | NZ_CP121355 | ||
Organism | Mesorhizobium sp. WSM4906 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | QAZ22_RS05615 | Protein ID | WP_278206015.1 |
Coordinates | 1178073..1178369 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QAZ22_RS05620 | Protein ID | WP_278206016.1 |
Coordinates | 1178377..1178685 (+) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QAZ22_RS05590 (QAZ22_05590) | 1174285..1175058 | + | 774 | WP_278206011.1 | FadR/GntR family transcriptional regulator | - |
QAZ22_RS05595 (QAZ22_05595) | 1175075..1175926 | + | 852 | WP_278207791.1 | 5-dehydro-4-deoxy-D-glucuronate isomerase | - |
QAZ22_RS05600 (QAZ22_05600) | 1175923..1176690 | + | 768 | WP_278206012.1 | 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD | - |
QAZ22_RS05605 (QAZ22_05605) | 1176719..1177051 | + | 333 | WP_278206013.1 | cupin domain-containing protein | - |
QAZ22_RS05610 (QAZ22_05610) | 1177323..1177949 | - | 627 | WP_278206014.1 | LysE family translocator | - |
QAZ22_RS05615 (QAZ22_05615) | 1178073..1178369 | + | 297 | WP_278206015.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QAZ22_RS05620 (QAZ22_05620) | 1178377..1178685 | + | 309 | WP_278206016.1 | HigA family addiction module antitoxin | Antitoxin |
QAZ22_RS05625 (QAZ22_05625) | 1178821..1180674 | + | 1854 | WP_278206017.1 | DNA helicase RecQ | - |
QAZ22_RS05630 (QAZ22_05630) | 1180712..1181605 | - | 894 | WP_278206018.1 | DUF1186 domain-containing protein | - |
QAZ22_RS05635 (QAZ22_05635) | 1181939..1183072 | + | 1134 | WP_278206019.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11804.33 Da Isoelectric Point: 6.8813
>T276283 WP_278206015.1 NZ_CP121355:1178073-1178369 [Mesorhizobium sp. WSM4906]
MILGFRDEWLRAFFVDDAHSRNIPSDLELRLFRKLQMIDDAMTDPDLRVPPSNHFEKLRGNLEGFHSIRVNKQWRLVFRW
DGRRGEASDVYLDDHSYR
MILGFRDEWLRAFFVDDAHSRNIPSDLELRLFRKLQMIDDAMTDPDLRVPPSNHFEKLRGNLEGFHSIRVNKQWRLVFRW
DGRRGEASDVYLDDHSYR
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|