Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2695340..2695862 | Replicon | chromosome |
Accession | NZ_CP121298 | ||
Organism | Salmonella enterica subsp. enterica strain KKP 3080 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | P1839_RS12980 | Protein ID | WP_000221343.1 |
Coordinates | 2695578..2695862 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | P1839_RS12975 | Protein ID | WP_000885424.1 |
Coordinates | 2695340..2695588 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1839_RS12950 (2690556) | 2690556..2692021 | + | 1466 | Protein_2510 | hypothetical protein | - |
P1839_RS12955 (2692829) | 2692829..2693543 | + | 715 | Protein_2511 | helix-turn-helix domain-containing protein | - |
P1839_RS12960 (2693599) | 2693599..2694507 | - | 909 | WP_010989018.1 | hypothetical protein | - |
P1839_RS12965 (2694650) | 2694650..2694983 | - | 334 | Protein_2513 | DUF1493 family protein | - |
P1839_RS12970 (2694973) | 2694973..2695188 | - | 216 | WP_000206207.1 | hypothetical protein | - |
P1839_RS12975 (2695340) | 2695340..2695588 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
P1839_RS12980 (2695578) | 2695578..2695862 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P1839_RS12985 (2696033) | 2696033..2696422 | + | 390 | WP_000194089.1 | RidA family protein | - |
P1839_RS12990 (2696474) | 2696474..2697553 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
P1839_RS12995 (2697746) | 2697746..2698234 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
P1839_RS13000 (2698279) | 2698279..2699787 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2690559..2702644 | 12085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T276261 WP_000221343.1 NZ_CP121298:2695578-2695862 [Salmonella enterica subsp. enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |