Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 159051..159805 | Replicon | chromosome |
| Accession | NZ_CP121298 | ||
| Organism | Salmonella enterica subsp. enterica strain KKP 3080 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | P1839_RS00745 | Protein ID | WP_000558166.1 |
| Coordinates | 159051..159362 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P1839_RS00750 | Protein ID | WP_001259011.1 |
| Coordinates | 159359..159805 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1839_RS00715 (154709) | 154709..155611 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| P1839_RS00720 (155608) | 155608..156243 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P1839_RS00725 (156240) | 156240..157169 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| P1839_RS00730 (157216) | 157216..157506 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| P1839_RS00735 (157507) | 157507..157818 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| P1839_RS00740 (158036) | 158036..158965 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| P1839_RS00745 (159051) | 159051..159362 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| P1839_RS00750 (159359) | 159359..159805 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| P1839_RS00755 (159820) | 159820..160761 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| P1839_RS00760 (160806) | 160806..161243 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| P1839_RS00765 (161253) | 161253..162020 | - | 768 | Protein_139 | virulence factor BrkB family protein | - |
| P1839_RS00770 (162107) | 162107..162706 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| P1839_RS00775 (162897) | 162897..163700 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| P1839_RS00780 (163734) | 163734..164630 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T276251 WP_000558166.1 NZ_CP121298:159051-159362 [Salmonella enterica subsp. enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT276251 WP_001259011.1 NZ_CP121298:159359-159805 [Salmonella enterica subsp. enterica]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|