Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1360942..1361696 | Replicon | chromosome |
| Accession | NZ_CP121296 | ||
| Organism | Salmonella enterica subsp. enterica strain KKP 1213 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | P1838_RS06490 | Protein ID | WP_000558166.1 |
| Coordinates | 1360942..1361253 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P1838_RS06495 | Protein ID | WP_001259009.1 |
| Coordinates | 1361250..1361696 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1838_RS06460 (1356599) | 1356599..1357502 | + | 904 | Protein_1246 | formate dehydrogenase subunit beta | - |
| P1838_RS06465 (1357499) | 1357499..1358134 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P1838_RS06470 (1358131) | 1358131..1359060 | + | 930 | WP_076737574.1 | formate dehydrogenase accessory protein FdhE | - |
| P1838_RS06475 (1359107) | 1359107..1359397 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| P1838_RS06480 (1359398) | 1359398..1359709 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| P1838_RS06485 (1359927) | 1359927..1360856 | + | 930 | WP_076737573.1 | alpha/beta hydrolase | - |
| P1838_RS06490 (1360942) | 1360942..1361253 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| P1838_RS06495 (1361250) | 1361250..1361696 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| P1838_RS06500 (1361711) | 1361711..1362652 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| P1838_RS06505 (1362697) | 1362697..1363134 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| P1838_RS06510 (1363131) | 1363131..1364003 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| P1838_RS06515 (1363997) | 1363997..1364596 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| P1838_RS06520 (1364787) | 1364787..1365591 | - | 805 | Protein_1258 | DeoR/GlpR family DNA-binding transcription regulator | - |
| P1838_RS06525 (1365625) | 1365625..1366521 | - | 897 | WP_071055644.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T276229 WP_000558166.1 NZ_CP121296:1360942-1361253 [Salmonella enterica subsp. enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT276229 WP_001259009.1 NZ_CP121296:1361250-1361696 [Salmonella enterica subsp. enterica]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|