Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 102648..103402 | Replicon | chromosome |
| Accession | NZ_CP121295 | ||
| Organism | Salmonella enterica subsp. enterica strain KKP 998 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | P1837_RS00450 | Protein ID | WP_000558166.1 |
| Coordinates | 102648..102959 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P1837_RS00455 | Protein ID | WP_001259009.1 |
| Coordinates | 102956..103402 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1837_RS00420 (98306) | 98306..99208 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| P1837_RS00425 (99205) | 99205..99840 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P1837_RS00430 (99837) | 99837..100766 | + | 930 | WP_076737574.1 | formate dehydrogenase accessory protein FdhE | - |
| P1837_RS00435 (100813) | 100813..101103 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| P1837_RS00440 (101104) | 101104..101415 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| P1837_RS00445 (101633) | 101633..102562 | + | 930 | WP_076737573.1 | alpha/beta hydrolase | - |
| P1837_RS00450 (102648) | 102648..102959 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| P1837_RS00455 (102956) | 102956..103402 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| P1837_RS00460 (103417) | 103417..104358 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| P1837_RS00465 (104403) | 104403..104840 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| P1837_RS00470 (104837) | 104837..105709 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| P1837_RS00475 (105703) | 105703..106302 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| P1837_RS00480 (106493) | 106493..107296 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| P1837_RS00485 (107330) | 107330..108226 | - | 897 | WP_071055644.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T276212 WP_000558166.1 NZ_CP121295:102648-102959 [Salmonella enterica subsp. enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT276212 WP_001259009.1 NZ_CP121295:102956-103402 [Salmonella enterica subsp. enterica]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|