Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
| Location | 4658057..4658598 | Replicon | chromosome |
| Accession | NZ_CP121294 | ||
| Organism | Escherichia coli O155:H21 strain NWU_1 | ||
Toxin (Protein)
| Gene name | yafQ | Uniprot ID | U9XPG0 |
| Locus tag | P9N54_RS22575 | Protein ID | WP_000615976.1 |
| Coordinates | 4658320..4658598 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | S1EWQ0 |
| Locus tag | P9N54_RS22570 | Protein ID | WP_000729704.1 |
| Coordinates | 4658057..4658317 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P9N54_RS22545 (4653840) | 4653840..4654625 | - | 786 | WP_000207575.1 | putative lateral flagellar export/assembly protein LafU | - |
| P9N54_RS22550 (4654597) | 4654597..4656309 | + | 1713 | Protein_4441 | flagellar biosynthesis protein FlhA | - |
| P9N54_RS22555 (4656414) | 4656414..4656692 | + | 279 | WP_000598760.1 | type II toxin-antitoxin system HicA family toxin | - |
| P9N54_RS22560 (4656685) | 4656685..4657041 | + | 357 | WP_001030483.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| P9N54_RS22565 (4657098) | 4657098..4657871 | - | 774 | WP_000543895.1 | C40 family peptidase | - |
| P9N54_RS22570 (4658057) | 4658057..4658317 | + | 261 | WP_000729704.1 | type II toxin-antitoxin system antitoxin DinJ | Antitoxin |
| P9N54_RS22575 (4658320) | 4658320..4658598 | + | 279 | WP_000615976.1 | type II toxin-antitoxin system mRNA interferase toxin YafQ | Toxin |
| P9N54_RS22580 (4658754) | 4658754..4659494 | + | 741 | WP_001225679.1 | peptidoglycan meso-diaminopimelic acid protein amidase | - |
| P9N54_RS22585 (4659465) | 4659465..4660232 | - | 768 | WP_000333380.1 | class II glutamine amidotransferase | - |
| P9N54_RS22590 (4660438) | 4660438..4661016 | - | 579 | WP_000284050.1 | D-sedoheptulose 7-phosphate isomerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10800.59 Da Isoelectric Point: 10.0702
>T276210 WP_000615976.1 NZ_CP121294:4658320-4658598 [Escherichia coli O155:H21]
MIQRDIEYSGQFSKDVKLAQKRHKDMNKLKYLMTLLINNALPLPAVYKDHPLQGSWKGYRDAHVEPDWILIYKLTDKLLR
FERTGTHAALFG
MIQRDIEYSGQFSKDVKLAQKRHKDMNKLKYLMTLLINNALPLPAVYKDHPLQGSWKGYRDAHVEPDWILIYKLTDKLLR
FERTGTHAALFG
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | U9XPG0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 4ML0 | |
| AlphaFold DB | A0A0E0Y6Z6 |