Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 4546598..4547397 | Replicon | chromosome |
Accession | NZ_CP121294 | ||
Organism | Escherichia coli O155:H21 strain NWU_1 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | F4VJD3 |
Locus tag | P9N54_RS21895 | Protein ID | WP_000347266.1 |
Coordinates | 4546598..4547062 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | P9N54_RS21900 | Protein ID | WP_001307405.1 |
Coordinates | 4547062..4547397 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9N54_RS21865 (4541599) | 4541599..4542033 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
P9N54_RS21870 (4542051) | 4542051..4542929 | - | 879 | WP_001315856.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
P9N54_RS21875 (4542919) | 4542919..4543698 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
P9N54_RS21880 (4543709) | 4543709..4544182 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
P9N54_RS21885 (4544205) | 4544205..4545485 | - | 1281 | WP_000681921.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
P9N54_RS21890 (4545734) | 4545734..4546543 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
P9N54_RS21895 (4546598) | 4546598..4547062 | - | 465 | WP_000347266.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
P9N54_RS21900 (4547062) | 4547062..4547397 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
P9N54_RS21905 (4547546) | 4547546..4549117 | - | 1572 | WP_001273741.1 | galactarate dehydratase | - |
P9N54_RS21910 (4549492) | 4549492..4550826 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
P9N54_RS21915 (4550842) | 4550842..4551612 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17841.18 Da Isoelectric Point: 9.4947
>T276209 WP_000347266.1 NZ_CP121294:c4547062-4546598 [Escherichia coli O155:H21]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Download Length: 112 a.a. Molecular weight: 12358.94 Da Isoelectric Point: 4.8616
>AT276209 WP_001307405.1 NZ_CP121294:c4547397-4547062 [Escherichia coli O155:H21]
MPANARSHAVLTTESKVTIRGQTTIPAPVREALKLKPGQDSIHYEILPGGQVFMCRLGDEQEDHTMNAFLRFLDADIQNN
PQKTRPFNIQQGKKLVAGMDVNIDDEIGDDE
MPANARSHAVLTTESKVTIRGQTTIPAPVREALKLKPGQDSIHYEILPGGQVFMCRLGDEQEDHTMNAFLRFLDADIQNN
PQKTRPFNIQQGKKLVAGMDVNIDDEIGDDE
Download Length: 336 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A836NGD2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |