Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 3910234..3910836 | Replicon | chromosome |
Accession | NZ_CP121294 | ||
Organism | Escherichia coli O155:H21 strain NWU_1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | P9N54_RS18815 | Protein ID | WP_000897305.1 |
Coordinates | 3910234..3910545 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | P9N54_RS18820 | Protein ID | WP_000356397.1 |
Coordinates | 3910546..3910836 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9N54_RS18785 (3905264) | 3905264..3906049 | + | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
P9N54_RS18790 (3906148) | 3906148..3906747 | + | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
P9N54_RS18795 (3906741) | 3906741..3907613 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
P9N54_RS18800 (3907610) | 3907610..3908047 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
P9N54_RS18805 (3908092) | 3908092..3909033 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
P9N54_RS18810 (3909097) | 3909097..3910005 | - | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
P9N54_RS18815 (3910234) | 3910234..3910545 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
P9N54_RS18820 (3910546) | 3910546..3910836 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
P9N54_RS18825 (3911441) | 3911441..3911659 | + | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
P9N54_RS18830 (3911879) | 3911879..3912121 | + | 243 | WP_001087409.1 | protein YiiF | - |
P9N54_RS18835 (3912451) | 3912451..3913380 | - | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
P9N54_RS18840 (3913377) | 3913377..3914012 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
P9N54_RS18845 (3914009) | 3914009..3914911 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T276207 WP_000897305.1 NZ_CP121294:3910234-3910545 [Escherichia coli O155:H21]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|