Detailed information of TA system TA276203

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-agrB/-
• Location: 3828029..3828450
• Replicon: chromosome
• Accession: NZ_CP121294
• Organism: Escherichia coli O155:H21 strain NWU_1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: P9N54_RS18455
• Protein ID: WP_096937776.1
• Coordinates: 3828029..3828154 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	agrB
Locus tag	-
Coordinates	3828252..3828450 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
P9N54_RS18415 (3823104)	3823104..3823331	-	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-
P9N54_RS18420 (3823425)	3823425..3824111	-	687	WP_000332492.1	PAS domain-containing protein	-
P9N54_RS18425 (3824301)	3824301..3824684	-	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
P9N54_RS18430 (3825006)	3825006..3825608	+	603	WP_000243701.1	transglycosylase SLT domain-containing protein	-
P9N54_RS18435 (3825904)	3825904..3826725	-	822	WP_001234417.1	DUF932 domain-containing protein	-
P9N54_RS18440 (3826844)	3826844..3827131	-	288	WP_000107542.1	hypothetical protein	-
P9N54_RS18445 (3827156)	3827156..3827362	-	207	WP_000547965.1	hypothetical protein	-
P9N54_RS18450 (3827432)	3827432..3827728	+	297	Protein_3631	hypothetical protein	-
P9N54_RS18455 (3828029)	3828029..3828154	-	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
P9N54_RS18460 (3828096)	3828096..3828245	-	150	Protein_3633	DUF5431 family protein	-
- (3828252)	3828252..3828450	-	199	NuclAT_1	-	-
- (3828252)	3828252..3828450	-	199	NuclAT_1	-	-
- (3828252)	3828252..3828450	-	199	NuclAT_1	-	-
- (3828252)	3828252..3828450	-	199	NuclAT_1	-	-
P9N54_RS18465 (3828419)	3828419..3829181	-	763	Protein_3634	plasmid SOS inhibition protein A	-
P9N54_RS18470 (3829178)	3829178..3829612	-	435	WP_000845928.1	conjugation system SOS inhibitor PsiB	-
P9N54_RS18475 (3829667)	3829667..3831625	-	1959	WP_000117173.1	ParB/RepB/Spo0J family partition protein	-
P9N54_RS18480 (3831691)	3831691..3831924	-	234	WP_000005990.1	DUF905 family protein	-
P9N54_RS18485 (3831981)	3831981..3832520	-	540	WP_000290801.1	single-stranded DNA-binding protein	-
P9N54_RS18490 (3832838)	3832838..3833347	+	510	WP_071600123.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Integrative and Conjugative Element	-	-	3807814..3853704	45890

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T276203 WP_096937776.1 NZ_CP121294:c3828154-3828029 [Escherichia coli O155:H21]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 199 bp

>AT276203 NZ_CP121294:3828252-3828450 [Escherichia coli O155:H21]
GCCTCGTGGGTTAATGAAAAATTAACTACGGGGCTTTTGTCCTTCTGCCACACAACACGGCAACAAACCACCTTCACGTC
ATGAGGCAGAAAGCCTCAAGCGCCGGGCACATCATAGCCCATATCCCTGCACGCTGACCACACTCACTTTTCCTGAAAAT
AACCCGCTCATTCAGGCTGTTTACGGGTAATCTGTGTGA

Structures

Antitoxin