Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 1176520..1176891 | Replicon | chromosome |
| Accession | NZ_CP121294 | ||
| Organism | Escherichia coli O155:H21 strain NWU_1 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | F4VC37 |
| Locus tag | P9N54_RS05895 | Protein ID | WP_001317028.1 |
| Coordinates | 1176697..1176891 (-) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 1176520..1176698 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P9N54_RS05865 (1172272) | 1172272..1172445 | + | 174 | WP_001296046.1 | protein YnaL | - |
| P9N54_RS05870 (1172475) | 1172475..1173848 | + | 1374 | WP_000123745.1 | ATP-dependent RNA helicase DbpA | - |
| P9N54_RS05875 (1173977) | 1173977..1174912 | - | 936 | WP_001157407.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| P9N54_RS05880 (1174964) | 1174964..1176199 | - | 1236 | WP_000040852.1 | site-specific integrase | - |
| P9N54_RS05885 (1176201) | 1176201..1176416 | - | 216 | WP_000079604.1 | excisionase XisR | - |
| - (1176520) | 1176520..1176698 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (1176520) | 1176520..1176698 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (1176520) | 1176520..1176698 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (1176520) | 1176520..1176698 | + | 179 | NuclAT_0 | - | Antitoxin |
| P9N54_RS05890 (1176516) | 1176516..1176704 | - | 189 | WP_001302840.1 | DUF1187 family protein | - |
| P9N54_RS05895 (1176697) | 1176697..1176891 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| P9N54_RS05900 (1176947) | 1176947..1177756 | - | 810 | WP_040088925.1 | recombination protein RecT | - |
| P9N54_RS05905 (1177749) | 1177749..1180370 | - | 2622 | WP_278234010.1 | exodeoxyribonuclease VIII | - |
| P9N54_RS05910 (1180472) | 1180472..1180747 | - | 276 | WP_000632297.1 | protein RacC | - |
| P9N54_RS05915 (1180822) | 1180822..1180992 | - | 171 | WP_001352098.1 | YdaE family protein | - |
| P9N54_RS05920 (1180992) | 1180992..1181213 | - | 222 | WP_000560223.1 | killing protein KilR | - |
| P9N54_RS05925 (1181635) | 1181635..1181787 | - | 153 | WP_001551042.1 | DUF1391 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1174964..1202487 | 27523 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T276189 WP_001317028.1 NZ_CP121294:c1176891-1176697 [Escherichia coli O155:H21]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT276189 NZ_CP121294:1176520-1176698 [Escherichia coli O155:H21]
GAGGACTGAAGTTTCTCGCAATTAAAATTAATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTAATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
