Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1039287..1039507 Replicon chromosome
Accession NZ_CP121294
Organism Escherichia coli O155:H21 strain NWU_1

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag P9N54_RS05185 Protein ID WP_000170965.1
Coordinates 1039287..1039394 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1039441..1039507 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P9N54_RS05155 1035142..1035975 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
P9N54_RS05160 1035972..1036364 + 393 WP_000200392.1 invasion regulator SirB2 -
P9N54_RS05165 1036368..1037177 + 810 WP_001257044.1 invasion regulator SirB1 -
P9N54_RS05170 1037213..1038067 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
P9N54_RS05175 1038216..1038323 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1038371..1038437 + 67 NuclAT_52 - -
- 1038371..1038437 + 67 NuclAT_52 - -
- 1038371..1038437 + 67 NuclAT_52 - -
- 1038371..1038437 + 67 NuclAT_52 - -
- 1038373..1038436 + 64 NuclAT_17 - -
- 1038373..1038436 + 64 NuclAT_17 - -
- 1038373..1038436 + 64 NuclAT_17 - -
- 1038373..1038436 + 64 NuclAT_17 - -
- 1038373..1038436 + 64 NuclAT_20 - -
- 1038373..1038436 + 64 NuclAT_20 - -
- 1038373..1038436 + 64 NuclAT_20 - -
- 1038373..1038436 + 64 NuclAT_20 - -
- 1038373..1038436 + 64 NuclAT_23 - -
- 1038373..1038436 + 64 NuclAT_23 - -
- 1038373..1038436 + 64 NuclAT_23 - -
- 1038373..1038436 + 64 NuclAT_23 - -
- 1038373..1038436 + 64 NuclAT_26 - -
- 1038373..1038436 + 64 NuclAT_26 - -
- 1038373..1038436 + 64 NuclAT_26 - -
- 1038373..1038436 + 64 NuclAT_26 - -
- 1038373..1038436 + 64 NuclAT_29 - -
- 1038373..1038436 + 64 NuclAT_29 - -
- 1038373..1038436 + 64 NuclAT_29 - -
- 1038373..1038436 + 64 NuclAT_29 - -
- 1038373..1038436 + 64 NuclAT_32 - -
- 1038373..1038436 + 64 NuclAT_32 - -
- 1038373..1038436 + 64 NuclAT_32 - -
- 1038373..1038436 + 64 NuclAT_32 - -
- 1038373..1038438 + 66 NuclAT_35 - -
- 1038373..1038438 + 66 NuclAT_35 - -
- 1038373..1038438 + 66 NuclAT_35 - -
- 1038373..1038438 + 66 NuclAT_35 - -
- 1038373..1038438 + 66 NuclAT_38 - -
- 1038373..1038438 + 66 NuclAT_38 - -
- 1038373..1038438 + 66 NuclAT_38 - -
- 1038373..1038438 + 66 NuclAT_38 - -
- 1038373..1038438 + 66 NuclAT_41 - -
- 1038373..1038438 + 66 NuclAT_41 - -
- 1038373..1038438 + 66 NuclAT_41 - -
- 1038373..1038438 + 66 NuclAT_41 - -
- 1038373..1038438 + 66 NuclAT_44 - -
- 1038373..1038438 + 66 NuclAT_44 - -
- 1038373..1038438 + 66 NuclAT_44 - -
- 1038373..1038438 + 66 NuclAT_44 - -
- 1038373..1038438 + 66 NuclAT_47 - -
- 1038373..1038438 + 66 NuclAT_47 - -
- 1038373..1038438 + 66 NuclAT_47 - -
- 1038373..1038438 + 66 NuclAT_47 - -
- 1038373..1038438 + 66 NuclAT_50 - -
- 1038373..1038438 + 66 NuclAT_50 - -
- 1038373..1038438 + 66 NuclAT_50 - -
- 1038373..1038438 + 66 NuclAT_50 - -
P9N54_RS05180 1038751..1038858 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1038911..1038972 + 62 NuclAT_18 - -
- 1038911..1038972 + 62 NuclAT_18 - -
- 1038911..1038972 + 62 NuclAT_18 - -
- 1038911..1038972 + 62 NuclAT_18 - -
- 1038911..1038972 + 62 NuclAT_21 - -
- 1038911..1038972 + 62 NuclAT_21 - -
- 1038911..1038972 + 62 NuclAT_21 - -
- 1038911..1038972 + 62 NuclAT_21 - -
- 1038911..1038972 + 62 NuclAT_24 - -
- 1038911..1038972 + 62 NuclAT_24 - -
- 1038911..1038972 + 62 NuclAT_24 - -
- 1038911..1038972 + 62 NuclAT_24 - -
- 1038911..1038972 + 62 NuclAT_27 - -
- 1038911..1038972 + 62 NuclAT_27 - -
- 1038911..1038972 + 62 NuclAT_27 - -
- 1038911..1038972 + 62 NuclAT_27 - -
- 1038911..1038972 + 62 NuclAT_30 - -
- 1038911..1038972 + 62 NuclAT_30 - -
- 1038911..1038972 + 62 NuclAT_30 - -
- 1038911..1038972 + 62 NuclAT_30 - -
- 1038911..1038972 + 62 NuclAT_33 - -
- 1038911..1038972 + 62 NuclAT_33 - -
- 1038911..1038972 + 62 NuclAT_33 - -
- 1038911..1038972 + 62 NuclAT_33 - -
- 1038911..1038973 + 63 NuclAT_53 - -
- 1038911..1038973 + 63 NuclAT_53 - -
- 1038911..1038973 + 63 NuclAT_53 - -
- 1038911..1038973 + 63 NuclAT_53 - -
- 1038911..1038974 + 64 NuclAT_36 - -
- 1038911..1038974 + 64 NuclAT_36 - -
- 1038911..1038974 + 64 NuclAT_36 - -
- 1038911..1038974 + 64 NuclAT_36 - -
- 1038911..1038974 + 64 NuclAT_39 - -
- 1038911..1038974 + 64 NuclAT_39 - -
- 1038911..1038974 + 64 NuclAT_39 - -
- 1038911..1038974 + 64 NuclAT_39 - -
- 1038911..1038974 + 64 NuclAT_42 - -
- 1038911..1038974 + 64 NuclAT_42 - -
- 1038911..1038974 + 64 NuclAT_42 - -
- 1038911..1038974 + 64 NuclAT_42 - -
- 1038911..1038974 + 64 NuclAT_45 - -
- 1038911..1038974 + 64 NuclAT_45 - -
- 1038911..1038974 + 64 NuclAT_45 - -
- 1038911..1038974 + 64 NuclAT_45 - -
- 1038911..1038974 + 64 NuclAT_48 - -
- 1038911..1038974 + 64 NuclAT_48 - -
- 1038911..1038974 + 64 NuclAT_48 - -
- 1038911..1038974 + 64 NuclAT_48 - -
- 1038911..1038974 + 64 NuclAT_51 - -
- 1038911..1038974 + 64 NuclAT_51 - -
- 1038911..1038974 + 64 NuclAT_51 - -
- 1038911..1038974 + 64 NuclAT_51 - -
P9N54_RS05185 1039287..1039394 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1039441..1039507 + 67 - - Antitoxin
P9N54_RS05190 1039799..1040899 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
P9N54_RS05195 1041169..1041399 + 231 WP_001146442.1 putative cation transport regulator ChaB -
P9N54_RS05200 1041557..1042252 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
P9N54_RS05205 1042296..1042649 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
P9N54_RS05210 1042834..1044228 + 1395 WP_000086201.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T276188 WP_000170965.1 NZ_CP121294:c1039394-1039287 [Escherichia coli O155:H21]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT276188 NZ_CP121294:1039441-1039507 [Escherichia coli O155:H21]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References