Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 1038751..1038972 | Replicon | chromosome |
Accession | NZ_CP121294 | ||
Organism | Escherichia coli O155:H21 strain NWU_1 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | E0IV43 |
Locus tag | P9N54_RS05180 | Protein ID | WP_000170926.1 |
Coordinates | 1038751..1038858 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 1038911..1038972 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9N54_RS05150 (1034060) | 1034060..1035142 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
P9N54_RS05155 (1035142) | 1035142..1035975 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
P9N54_RS05160 (1035972) | 1035972..1036364 | + | 393 | WP_000200392.1 | invasion regulator SirB2 | - |
P9N54_RS05165 (1036368) | 1036368..1037177 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
P9N54_RS05170 (1037213) | 1037213..1038067 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
P9N54_RS05175 (1038216) | 1038216..1038323 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (1038373) | 1038373..1038436 | + | 64 | NuclAT_17 | - | - |
- (1038373) | 1038373..1038436 | + | 64 | NuclAT_17 | - | - |
- (1038373) | 1038373..1038436 | + | 64 | NuclAT_17 | - | - |
- (1038373) | 1038373..1038436 | + | 64 | NuclAT_17 | - | - |
- (1038373) | 1038373..1038436 | + | 64 | NuclAT_20 | - | - |
- (1038373) | 1038373..1038436 | + | 64 | NuclAT_20 | - | - |
- (1038373) | 1038373..1038436 | + | 64 | NuclAT_20 | - | - |
- (1038373) | 1038373..1038436 | + | 64 | NuclAT_20 | - | - |
- (1038373) | 1038373..1038436 | + | 64 | NuclAT_23 | - | - |
- (1038373) | 1038373..1038436 | + | 64 | NuclAT_23 | - | - |
- (1038373) | 1038373..1038436 | + | 64 | NuclAT_23 | - | - |
- (1038373) | 1038373..1038436 | + | 64 | NuclAT_23 | - | - |
- (1038373) | 1038373..1038436 | + | 64 | NuclAT_26 | - | - |
- (1038373) | 1038373..1038436 | + | 64 | NuclAT_26 | - | - |
- (1038373) | 1038373..1038436 | + | 64 | NuclAT_26 | - | - |
- (1038373) | 1038373..1038436 | + | 64 | NuclAT_26 | - | - |
- (1038373) | 1038373..1038436 | + | 64 | NuclAT_29 | - | - |
- (1038373) | 1038373..1038436 | + | 64 | NuclAT_29 | - | - |
- (1038373) | 1038373..1038436 | + | 64 | NuclAT_29 | - | - |
- (1038373) | 1038373..1038436 | + | 64 | NuclAT_29 | - | - |
- (1038373) | 1038373..1038436 | + | 64 | NuclAT_32 | - | - |
- (1038373) | 1038373..1038436 | + | 64 | NuclAT_32 | - | - |
- (1038373) | 1038373..1038436 | + | 64 | NuclAT_32 | - | - |
- (1038373) | 1038373..1038436 | + | 64 | NuclAT_32 | - | - |
- (1038371) | 1038371..1038437 | + | 67 | NuclAT_52 | - | - |
- (1038371) | 1038371..1038437 | + | 67 | NuclAT_52 | - | - |
- (1038371) | 1038371..1038437 | + | 67 | NuclAT_52 | - | - |
- (1038371) | 1038371..1038437 | + | 67 | NuclAT_52 | - | - |
- (1038373) | 1038373..1038438 | + | 66 | NuclAT_35 | - | - |
- (1038373) | 1038373..1038438 | + | 66 | NuclAT_35 | - | - |
- (1038373) | 1038373..1038438 | + | 66 | NuclAT_35 | - | - |
- (1038373) | 1038373..1038438 | + | 66 | NuclAT_35 | - | - |
- (1038373) | 1038373..1038438 | + | 66 | NuclAT_38 | - | - |
- (1038373) | 1038373..1038438 | + | 66 | NuclAT_38 | - | - |
- (1038373) | 1038373..1038438 | + | 66 | NuclAT_38 | - | - |
- (1038373) | 1038373..1038438 | + | 66 | NuclAT_38 | - | - |
- (1038373) | 1038373..1038438 | + | 66 | NuclAT_41 | - | - |
- (1038373) | 1038373..1038438 | + | 66 | NuclAT_41 | - | - |
- (1038373) | 1038373..1038438 | + | 66 | NuclAT_41 | - | - |
- (1038373) | 1038373..1038438 | + | 66 | NuclAT_41 | - | - |
- (1038373) | 1038373..1038438 | + | 66 | NuclAT_44 | - | - |
- (1038373) | 1038373..1038438 | + | 66 | NuclAT_44 | - | - |
- (1038373) | 1038373..1038438 | + | 66 | NuclAT_44 | - | - |
- (1038373) | 1038373..1038438 | + | 66 | NuclAT_44 | - | - |
- (1038373) | 1038373..1038438 | + | 66 | NuclAT_47 | - | - |
- (1038373) | 1038373..1038438 | + | 66 | NuclAT_47 | - | - |
- (1038373) | 1038373..1038438 | + | 66 | NuclAT_47 | - | - |
- (1038373) | 1038373..1038438 | + | 66 | NuclAT_47 | - | - |
- (1038373) | 1038373..1038438 | + | 66 | NuclAT_50 | - | - |
- (1038373) | 1038373..1038438 | + | 66 | NuclAT_50 | - | - |
- (1038373) | 1038373..1038438 | + | 66 | NuclAT_50 | - | - |
- (1038373) | 1038373..1038438 | + | 66 | NuclAT_50 | - | - |
P9N54_RS05180 (1038751) | 1038751..1038858 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- (1038911) | 1038911..1038972 | + | 62 | NuclAT_18 | - | Antitoxin |
- (1038911) | 1038911..1038972 | + | 62 | NuclAT_18 | - | Antitoxin |
- (1038911) | 1038911..1038972 | + | 62 | NuclAT_18 | - | Antitoxin |
- (1038911) | 1038911..1038972 | + | 62 | NuclAT_18 | - | Antitoxin |
- (1038911) | 1038911..1038972 | + | 62 | NuclAT_21 | - | Antitoxin |
- (1038911) | 1038911..1038972 | + | 62 | NuclAT_21 | - | Antitoxin |
- (1038911) | 1038911..1038972 | + | 62 | NuclAT_21 | - | Antitoxin |
- (1038911) | 1038911..1038972 | + | 62 | NuclAT_21 | - | Antitoxin |
- (1038911) | 1038911..1038972 | + | 62 | NuclAT_24 | - | Antitoxin |
- (1038911) | 1038911..1038972 | + | 62 | NuclAT_24 | - | Antitoxin |
- (1038911) | 1038911..1038972 | + | 62 | NuclAT_24 | - | Antitoxin |
- (1038911) | 1038911..1038972 | + | 62 | NuclAT_24 | - | Antitoxin |
- (1038911) | 1038911..1038972 | + | 62 | NuclAT_27 | - | Antitoxin |
- (1038911) | 1038911..1038972 | + | 62 | NuclAT_27 | - | Antitoxin |
- (1038911) | 1038911..1038972 | + | 62 | NuclAT_27 | - | Antitoxin |
- (1038911) | 1038911..1038972 | + | 62 | NuclAT_27 | - | Antitoxin |
- (1038911) | 1038911..1038972 | + | 62 | NuclAT_30 | - | Antitoxin |
- (1038911) | 1038911..1038972 | + | 62 | NuclAT_30 | - | Antitoxin |
- (1038911) | 1038911..1038972 | + | 62 | NuclAT_30 | - | Antitoxin |
- (1038911) | 1038911..1038972 | + | 62 | NuclAT_30 | - | Antitoxin |
- (1038911) | 1038911..1038972 | + | 62 | NuclAT_33 | - | Antitoxin |
- (1038911) | 1038911..1038972 | + | 62 | NuclAT_33 | - | Antitoxin |
- (1038911) | 1038911..1038972 | + | 62 | NuclAT_33 | - | Antitoxin |
- (1038911) | 1038911..1038972 | + | 62 | NuclAT_33 | - | Antitoxin |
- (1038911) | 1038911..1038973 | + | 63 | NuclAT_53 | - | - |
- (1038911) | 1038911..1038973 | + | 63 | NuclAT_53 | - | - |
- (1038911) | 1038911..1038973 | + | 63 | NuclAT_53 | - | - |
- (1038911) | 1038911..1038973 | + | 63 | NuclAT_53 | - | - |
- (1038911) | 1038911..1038974 | + | 64 | NuclAT_36 | - | - |
- (1038911) | 1038911..1038974 | + | 64 | NuclAT_36 | - | - |
- (1038911) | 1038911..1038974 | + | 64 | NuclAT_36 | - | - |
- (1038911) | 1038911..1038974 | + | 64 | NuclAT_36 | - | - |
- (1038911) | 1038911..1038974 | + | 64 | NuclAT_39 | - | - |
- (1038911) | 1038911..1038974 | + | 64 | NuclAT_39 | - | - |
- (1038911) | 1038911..1038974 | + | 64 | NuclAT_39 | - | - |
- (1038911) | 1038911..1038974 | + | 64 | NuclAT_39 | - | - |
- (1038911) | 1038911..1038974 | + | 64 | NuclAT_42 | - | - |
- (1038911) | 1038911..1038974 | + | 64 | NuclAT_42 | - | - |
- (1038911) | 1038911..1038974 | + | 64 | NuclAT_42 | - | - |
- (1038911) | 1038911..1038974 | + | 64 | NuclAT_42 | - | - |
- (1038911) | 1038911..1038974 | + | 64 | NuclAT_45 | - | - |
- (1038911) | 1038911..1038974 | + | 64 | NuclAT_45 | - | - |
- (1038911) | 1038911..1038974 | + | 64 | NuclAT_45 | - | - |
- (1038911) | 1038911..1038974 | + | 64 | NuclAT_45 | - | - |
- (1038911) | 1038911..1038974 | + | 64 | NuclAT_48 | - | - |
- (1038911) | 1038911..1038974 | + | 64 | NuclAT_48 | - | - |
- (1038911) | 1038911..1038974 | + | 64 | NuclAT_48 | - | - |
- (1038911) | 1038911..1038974 | + | 64 | NuclAT_48 | - | - |
- (1038911) | 1038911..1038974 | + | 64 | NuclAT_51 | - | - |
- (1038911) | 1038911..1038974 | + | 64 | NuclAT_51 | - | - |
- (1038911) | 1038911..1038974 | + | 64 | NuclAT_51 | - | - |
- (1038911) | 1038911..1038974 | + | 64 | NuclAT_51 | - | - |
P9N54_RS05185 (1039287) | 1039287..1039394 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (1039442) | 1039442..1039507 | + | 66 | NuclAT_16 | - | - |
- (1039442) | 1039442..1039507 | + | 66 | NuclAT_16 | - | - |
- (1039442) | 1039442..1039507 | + | 66 | NuclAT_16 | - | - |
- (1039442) | 1039442..1039507 | + | 66 | NuclAT_16 | - | - |
- (1039442) | 1039442..1039507 | + | 66 | NuclAT_19 | - | - |
- (1039442) | 1039442..1039507 | + | 66 | NuclAT_19 | - | - |
- (1039442) | 1039442..1039507 | + | 66 | NuclAT_19 | - | - |
- (1039442) | 1039442..1039507 | + | 66 | NuclAT_19 | - | - |
- (1039442) | 1039442..1039507 | + | 66 | NuclAT_22 | - | - |
- (1039442) | 1039442..1039507 | + | 66 | NuclAT_22 | - | - |
- (1039442) | 1039442..1039507 | + | 66 | NuclAT_22 | - | - |
- (1039442) | 1039442..1039507 | + | 66 | NuclAT_22 | - | - |
- (1039442) | 1039442..1039507 | + | 66 | NuclAT_25 | - | - |
- (1039442) | 1039442..1039507 | + | 66 | NuclAT_25 | - | - |
- (1039442) | 1039442..1039507 | + | 66 | NuclAT_25 | - | - |
- (1039442) | 1039442..1039507 | + | 66 | NuclAT_25 | - | - |
- (1039442) | 1039442..1039507 | + | 66 | NuclAT_28 | - | - |
- (1039442) | 1039442..1039507 | + | 66 | NuclAT_28 | - | - |
- (1039442) | 1039442..1039507 | + | 66 | NuclAT_28 | - | - |
- (1039442) | 1039442..1039507 | + | 66 | NuclAT_28 | - | - |
- (1039442) | 1039442..1039507 | + | 66 | NuclAT_31 | - | - |
- (1039442) | 1039442..1039507 | + | 66 | NuclAT_31 | - | - |
- (1039442) | 1039442..1039507 | + | 66 | NuclAT_31 | - | - |
- (1039442) | 1039442..1039507 | + | 66 | NuclAT_31 | - | - |
- (1039443) | 1039443..1039508 | + | 66 | NuclAT_54 | - | - |
- (1039443) | 1039443..1039508 | + | 66 | NuclAT_54 | - | - |
- (1039443) | 1039443..1039508 | + | 66 | NuclAT_54 | - | - |
- (1039443) | 1039443..1039508 | + | 66 | NuclAT_54 | - | - |
- (1039442) | 1039442..1039509 | + | 68 | NuclAT_34 | - | - |
- (1039442) | 1039442..1039509 | + | 68 | NuclAT_34 | - | - |
- (1039442) | 1039442..1039509 | + | 68 | NuclAT_34 | - | - |
- (1039442) | 1039442..1039509 | + | 68 | NuclAT_34 | - | - |
- (1039442) | 1039442..1039509 | + | 68 | NuclAT_37 | - | - |
- (1039442) | 1039442..1039509 | + | 68 | NuclAT_37 | - | - |
- (1039442) | 1039442..1039509 | + | 68 | NuclAT_37 | - | - |
- (1039442) | 1039442..1039509 | + | 68 | NuclAT_37 | - | - |
- (1039442) | 1039442..1039509 | + | 68 | NuclAT_40 | - | - |
- (1039442) | 1039442..1039509 | + | 68 | NuclAT_40 | - | - |
- (1039442) | 1039442..1039509 | + | 68 | NuclAT_40 | - | - |
- (1039442) | 1039442..1039509 | + | 68 | NuclAT_40 | - | - |
- (1039442) | 1039442..1039509 | + | 68 | NuclAT_43 | - | - |
- (1039442) | 1039442..1039509 | + | 68 | NuclAT_43 | - | - |
- (1039442) | 1039442..1039509 | + | 68 | NuclAT_43 | - | - |
- (1039442) | 1039442..1039509 | + | 68 | NuclAT_43 | - | - |
- (1039442) | 1039442..1039509 | + | 68 | NuclAT_46 | - | - |
- (1039442) | 1039442..1039509 | + | 68 | NuclAT_46 | - | - |
- (1039442) | 1039442..1039509 | + | 68 | NuclAT_46 | - | - |
- (1039442) | 1039442..1039509 | + | 68 | NuclAT_46 | - | - |
- (1039442) | 1039442..1039509 | + | 68 | NuclAT_49 | - | - |
- (1039442) | 1039442..1039509 | + | 68 | NuclAT_49 | - | - |
- (1039442) | 1039442..1039509 | + | 68 | NuclAT_49 | - | - |
- (1039442) | 1039442..1039509 | + | 68 | NuclAT_49 | - | - |
P9N54_RS05190 (1039799) | 1039799..1040899 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
P9N54_RS05195 (1041169) | 1041169..1041399 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
P9N54_RS05200 (1041557) | 1041557..1042252 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
P9N54_RS05205 (1042296) | 1042296..1042649 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.84 Da Isoelectric Point: 11.6501
>T276184 WP_000170926.1 NZ_CP121294:c1038858-1038751 [Escherichia coli O155:H21]
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 62 bp
>AT276184 NZ_CP121294:1038911-1038972 [Escherichia coli O155:H21]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|