Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 3553468..3554143 | Replicon | chromosome |
Accession | NZ_CP121269 | ||
Organism | Enterobacter hormaechei subsp. xiangfangensis strain F81Y |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | P9J39_RS16825 | Protein ID | WP_278106349.1 |
Coordinates | 3553468..3553767 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A2J0PXC9 |
Locus tag | P9J39_RS16830 | Protein ID | WP_015571639.1 |
Coordinates | 3553778..3554143 (+) | Length | 122 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9J39_RS16815 (P9J39_16815) | 3549845..3552037 | + | 2193 | WP_017692801.1 | type I secretion system permease/ATPase | - |
P9J39_RS16820 (P9J39_16820) | 3552018..3553217 | + | 1200 | WP_017382757.1 | HlyD family efflux transporter periplasmic adaptor subunit | - |
P9J39_RS16825 (P9J39_16825) | 3553468..3553767 | + | 300 | WP_278106349.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P9J39_RS16830 (P9J39_16830) | 3553778..3554143 | + | 366 | WP_015571639.1 | HigA family addiction module antitoxin | Antitoxin |
P9J39_RS16835 (P9J39_16835) | 3554170..3555351 | - | 1182 | WP_017382758.1 | PLP-dependent aminotransferase family protein | - |
P9J39_RS16840 (P9J39_16840) | 3555372..3556259 | - | 888 | WP_015571641.1 | LysR family transcriptional regulator | - |
P9J39_RS16845 (P9J39_16845) | 3556357..3556959 | + | 603 | WP_045340137.1 | short chain dehydrogenase | - |
P9J39_RS16850 (P9J39_16850) | 3556956..3557687 | - | 732 | WP_017382760.1 | methyltransferase domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11654.31 Da Isoelectric Point: 9.3210
>T276169 WP_278106349.1 NZ_CP121269:3553468-3553767 [Enterobacter hormaechei subsp. xiangfangensis]
MINHFWDQWLEDFFLYGRSSNVIPLNLETALARKLDIINAAMSHLDLRSPPGNMYEALSPPLKGYSSIRVNRQYRLVFRW
SEGKADDLYLSPHKYTQHK
MINHFWDQWLEDFFLYGRSSNVIPLNLETALARKLDIINAAMSHLDLRSPPGNMYEALSPPLKGYSSIRVNRQYRLVFRW
SEGKADDLYLSPHKYTQHK
Download Length: 300 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13705.73 Da Isoelectric Point: 9.5936
>AT276169 WP_015571639.1 NZ_CP121269:3553778-3554143 [Enterobacter hormaechei subsp. xiangfangensis]
MTLQQALRKPTTPGEVLQYEYLEPLNLKINDLAEMLNVHRNTVSALVNNNRKLTADMAIKLAKAFNTTIEFWLNLQLNVD
IWEAQSNSRTQEELSRIKTVAEVMAKRKSGKPDVTLHGNSA
MTLQQALRKPTTPGEVLQYEYLEPLNLKINDLAEMLNVHRNTVSALVNNNRKLTADMAIKLAKAFNTTIEFWLNLQLNVD
IWEAQSNSRTQEELSRIKTVAEVMAKRKSGKPDVTLHGNSA
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|