Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2415296..2415818 | Replicon | chromosome |
Accession | NZ_CP121262 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain 013 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | P8621_RS11835 | Protein ID | WP_000221343.1 |
Coordinates | 2415534..2415818 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | P8621_RS11830 | Protein ID | WP_000885424.1 |
Coordinates | 2415296..2415544 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8621_RS11805 (2410512) | 2410512..2411978 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
P8621_RS11810 (2412786) | 2412786..2413500 | + | 715 | Protein_2307 | helix-turn-helix domain-containing protein | - |
P8621_RS11815 (2413556) | 2413556..2414464 | - | 909 | WP_010989018.1 | hypothetical protein | - |
P8621_RS11820 (2414607) | 2414607..2414939 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
P8621_RS11825 (2414929) | 2414929..2415144 | - | 216 | WP_000206207.1 | hypothetical protein | - |
P8621_RS11830 (2415296) | 2415296..2415544 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
P8621_RS11835 (2415534) | 2415534..2415818 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P8621_RS11840 (2415989) | 2415989..2416378 | + | 390 | WP_000194089.1 | RidA family protein | - |
P8621_RS11845 (2416430) | 2416430..2417509 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
P8621_RS11850 (2417702) | 2417702..2418190 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
P8621_RS11855 (2418235) | 2418235..2419743 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2410515..2422600 | 12085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T276148 WP_000221343.1 NZ_CP121262:2415534-2415818 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |