Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 736708..737366 | Replicon | chromosome |
| Accession | NZ_CP121247 | ||
| Organism | Arcanobacterium wilhelmae strain DSM 102162 | ||
Toxin (Protein)
| Gene name | HigB2 | Uniprot ID | - |
| Locus tag | P8A24_RS03230 | Protein ID | WP_278059682.1 |
| Coordinates | 737013..737366 (-) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | HigA2 | Uniprot ID | - |
| Locus tag | P8A24_RS03225 | Protein ID | WP_278059680.1 |
| Coordinates | 736708..737016 (-) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8A24_RS03205 (P8A24_03205) | 732736..733749 | - | 1014 | WP_278059673.1 | polysaccharide deacetylase family protein | - |
| P8A24_RS03210 (P8A24_03210) | 733889..734746 | - | 858 | WP_278059675.1 | glutaminyl-peptide cyclotransferase | - |
| P8A24_RS03215 (P8A24_03215) | 734983..735234 | - | 252 | WP_278059676.1 | type B 50S ribosomal protein L31 | - |
| P8A24_RS03220 (P8A24_03220) | 735483..736706 | + | 1224 | WP_278059678.1 | amidohydrolase | - |
| P8A24_RS03225 (P8A24_03225) | 736708..737016 | - | 309 | WP_278059680.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| P8A24_RS03230 (P8A24_03230) | 737013..737366 | - | 354 | WP_278059682.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P8A24_RS03235 (P8A24_03235) | 737421..738269 | - | 849 | WP_278059684.1 | M15 family metallopeptidase | - |
| P8A24_RS03240 (P8A24_03240) | 738368..739354 | - | 987 | WP_278059686.1 | PRD domain-containing protein | - |
| P8A24_RS03245 (P8A24_03245) | 739606..741636 | - | 2031 | WP_278059688.1 | glucose PTS transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13370.42 Da Isoelectric Point: 10.4050
>T276130 WP_278059682.1 NZ_CP121247:c737366-737013 [Arcanobacterium wilhelmae]
VWEIDVEPVADWLSRLDPSSSVQVIAALELLREHGPSLGRPLVDTISGSRHKNMKELWPGSSGRSKIRLLFIFDPNRRAI
ILIAGDKSGQWTKWYKTNIPIADDRYDLHLKQLKRGK
VWEIDVEPVADWLSRLDPSSSVQVIAALELLREHGPSLGRPLVDTISGSRHKNMKELWPGSSGRSKIRLLFIFDPNRRAI
ILIAGDKSGQWTKWYKTNIPIADDRYDLHLKQLKRGK
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|