Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 52186..52867 | Replicon | chromosome |
| Accession | NZ_CP121247 | ||
| Organism | Arcanobacterium wilhelmae strain DSM 102162 | ||
Toxin (Protein)
| Gene name | HigB2 | Uniprot ID | - |
| Locus tag | P8A24_RS00280 | Protein ID | WP_278058550.1 |
| Coordinates | 52508..52867 (-) | Length | 120 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P8A24_RS00275 | Protein ID | WP_278058549.1 |
| Coordinates | 52186..52494 (-) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8A24_RS00255 (P8A24_00255) | 48713..50005 | + | 1293 | WP_278058541.1 | hypothetical protein | - |
| P8A24_RS00260 (P8A24_00260) | 50156..50839 | + | 684 | WP_278058543.1 | hydrolase | - |
| P8A24_RS00265 (P8A24_00265) | 50999..51331 | + | 333 | WP_278058545.1 | TM2 domain-containing protein | - |
| P8A24_RS00270 (P8A24_00270) | 51459..52082 | - | 624 | WP_278058547.1 | MBL fold metallo-hydrolase | - |
| P8A24_RS00275 (P8A24_00275) | 52186..52494 | - | 309 | WP_278058549.1 | XRE family transcriptional regulator | Antitoxin |
| P8A24_RS00280 (P8A24_00280) | 52508..52867 | - | 360 | WP_278058550.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P8A24_RS00285 (P8A24_00285) | 53042..54052 | - | 1011 | WP_278058551.1 | type I glyceraldehyde-3-phosphate dehydrogenase | - |
| P8A24_RS00290 (P8A24_00290) | 54271..55836 | - | 1566 | WP_278058553.1 | alkyl hydroperoxide reductase subunit F | - |
| P8A24_RS00295 (P8A24_00295) | 55903..56466 | - | 564 | WP_278058555.1 | alkyl hydroperoxide reductase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13828.84 Da Isoelectric Point: 6.4879
>T276128 WP_278058550.1 NZ_CP121247:c52867-52508 [Arcanobacterium wilhelmae]
MWEIILMKQVEDWLLNLTDDDYDLVAAAITRLETAGPALGRPTADHIKASRHHNMKELRPGSRGRSKIRILFAFDPHRQA
VLLIAGDKADKWSEWYKTNIPRADALFDEWLLQLKTYEE
MWEIILMKQVEDWLLNLTDDDYDLVAAAITRLETAGPALGRPTADHIKASRHHNMKELRPGSRGRSKIRILFAFDPHRQA
VLLIAGDKADKWSEWYKTNIPRADALFDEWLLQLKTYEE
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|