Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2654577..2654838 | Replicon | chromosome |
Accession | NZ_CP121233 | ||
Organism | Enterococcus faecalis strain SVJ-EF01 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | S4BYM2 |
Locus tag | ORD27_RS13000 | Protein ID | WP_002392696.1 |
Coordinates | 2654695..2654838 (-) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2654577..2654762 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORD27_RS12985 (2649990) | 2649990..2652734 | + | 2745 | WP_104876100.1 | glycosyl hydrolase family 65 protein | - |
ORD27_RS12990 (2652749) | 2652749..2653399 | + | 651 | WP_085443093.1 | beta-phosphoglucomutase | - |
ORD27_RS12995 (2653861) | 2653861..2654454 | + | 594 | WP_010706987.1 | PBECR4 domain-containing protein | - |
- (2654577) | 2654577..2654762 | + | 186 | NuclAT_6 | - | Antitoxin |
ORD27_RS13000 (2654695) | 2654695..2654838 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
- (2655015) | 2655015..2655202 | + | 188 | NuclAT_5 | - | - |
ORD27_RS13005 (2655135) | 2655135..2655278 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | - |
ORD27_RS13010 (2655511) | 2655511..2656482 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
ORD27_RS13015 (2656657) | 2656657..2657094 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
ORD27_RS13020 (2657227) | 2657227..2657781 | - | 555 | WP_002354869.1 | Maf family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5297.43 Da Isoelectric Point: 10.6867
>T276117 WP_002392696.1 NZ_CP121233:c2654838-2654695 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 144 bp
Antitoxin
Download Length: 186 bp
>AT276117 NZ_CP121233:2654577-2654762 [Enterococcus faecalis]
TGCTATAATAAAAACGAAAAGAGAGATATGCGTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCATGTTA
ATTATTTAAAAATAACCGTGCTTGGTCAAAGTTGACGGTTATTTTTTATTGTCATTTTTAAGCAATTTAACAATCAGCGC
AATCAAAGCAATGGTAAACATACCAA
TGCTATAATAAAAACGAAAAGAGAGATATGCGTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCATGTTA
ATTATTTAAAAATAACCGTGCTTGGTCAAAGTTGACGGTTATTTTTTATTGTCATTTTTAAGCAATTTAACAATCAGCGC
AATCAAAGCAATGGTAAACATACCAA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|