Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3822408..3822633 | Replicon | chromosome |
| Accession | NZ_CP121223 | ||
| Organism | Shigella flexneri 2a strain Sflex 21-42 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | P5F89_RS21015 | Protein ID | WP_000813254.1 |
| Coordinates | 3822478..3822633 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 3822408..3822466 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5F89_RS20975 | 3818406..3818575 | + | 170 | Protein_3676 | hypothetical protein | - |
| P5F89_RS20980 | 3818721..3819467 | + | 747 | WP_000788996.1 | ATP-binding protein | - |
| P5F89_RS20985 | 3819482..3819904 | + | 423 | WP_001118168.1 | DUF977 family protein | - |
| P5F89_RS20990 | 3819962..3820318 | + | 357 | WP_005048249.1 | hypothetical protein | - |
| P5F89_RS20995 | 3820411..3820629 | + | 219 | WP_000256998.1 | DUF4014 family protein | - |
| P5F89_RS21000 | 3820631..3820996 | + | 366 | WP_001229297.1 | HNH endonuclease signature motif containing protein | - |
| P5F89_RS21005 | 3820993..3821658 | + | 666 | WP_000208062.1 | hypothetical protein | - |
| P5F89_RS21010 | 3821658..3822023 | + | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
| - | 3822408..3822466 | - | 59 | - | - | Antitoxin |
| P5F89_RS21015 | 3822478..3822633 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| P5F89_RS21025 | 3823970..3824569 | + | 600 | WP_094107379.1 | DUF1367 family protein | - |
| P5F89_RS21030 | 3824569..3824859 | + | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
| P5F89_RS21035 | 3824856..3825410 | + | 555 | WP_289228590.1 | DUF1133 family protein | - |
| P5F89_RS21040 | 3825563..3825736 | + | 174 | WP_000504450.1 | hypothetical protein | - |
| P5F89_RS21045 | 3825798..3826937 | + | 1140 | WP_000088354.1 | IS3 family transposase | - |
| P5F89_RS21050 | 3826930..3827490 | + | 561 | WP_072075205.1 | ORF6N domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | sitABCD | ipaH9.8 | 3810395..3876367 | 65972 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T276099 WP_000813254.1 NZ_CP121223:3822478-3822633 [Shigella flexneri 2a]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT276099 NZ_CP121223:c3822466-3822408 [Shigella flexneri 2a]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|