Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 2807215..2807833 | Replicon | chromosome |
| Accession | NZ_CP121223 | ||
| Organism | Shigella flexneri 2a strain Sflex 21-42 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | P5F89_RS15785 | Protein ID | WP_001291435.1 |
| Coordinates | 2807215..2807433 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | Q0T7C3 |
| Locus tag | P5F89_RS15790 | Protein ID | WP_000344797.1 |
| Coordinates | 2807459..2807833 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5F89_RS15755 (2803107) | 2803107..2803418 | - | 312 | WP_000409911.1 | MGMT family protein | - |
| P5F89_RS15765 (2803797) | 2803797..2804150 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| P5F89_RS15770 (2804192) | 2804192..2805742 | - | 1551 | WP_005098218.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| P5F89_RS15775 (2805906) | 2805906..2806376 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| P5F89_RS15780 (2806492) | 2806492..2807043 | - | 552 | Protein_2663 | maltose O-acetyltransferase | - |
| P5F89_RS15785 (2807215) | 2807215..2807433 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| P5F89_RS15790 (2807459) | 2807459..2807833 | - | 375 | WP_000344797.1 | Hha toxicity modulator TomB | Antitoxin |
| P5F89_RS15795 (2808379) | 2808379..2811528 | - | 3150 | WP_001132484.1 | efflux RND transporter permease AcrB | - |
| P5F89_RS15800 (2811551) | 2811551..2812744 | - | 1194 | WP_011069267.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 2801749..2803077 | 1328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T276097 WP_001291435.1 NZ_CP121223:c2807433-2807215 [Shigella flexneri 2a]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14513.38 Da Isoelectric Point: 4.9091
>AT276097 WP_000344797.1 NZ_CP121223:c2807833-2807459 [Shigella flexneri 2a]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TPD8 |