Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 2770033..2770877 | Replicon | chromosome |
Accession | NZ_CP121223 | ||
Organism | Shigella flexneri 2a strain Sflex 21-42 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | - |
Locus tag | P5F89_RS15590 | Protein ID | WP_014532172.1 |
Coordinates | 2770033..2770494 (-) | Length | 154 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | A5H0K0 |
Locus tag | P5F89_RS15595 | Protein ID | WP_005053053.1 |
Coordinates | 2770566..2770877 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5F89_RS15575 (2765201) | 2765201..2766931 | - | 1731 | WP_000645013.1 | hypothetical protein | - |
P5F89_RS15580 (2766984) | 2766984..2769137 | - | 2154 | WP_005060811.1 | SEL1-like repeat protein | - |
P5F89_RS15585 (2769288) | 2769288..2769985 | + | 698 | WP_252965753.1 | IS1 family transposase | - |
P5F89_RS15590 (2770033) | 2770033..2770494 | - | 462 | WP_014532172.1 | GNAT family N-acetyltransferase | Toxin |
P5F89_RS15595 (2770566) | 2770566..2770877 | - | 312 | WP_005053053.1 | DUF1778 domain-containing protein | Antitoxin |
P5F89_RS15600 (2771061) | 2771061..2771951 | - | 891 | WP_000971346.1 | heme o synthase | - |
P5F89_RS15605 (2771963) | 2771963..2772292 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
P5F89_RS15610 (2772292) | 2772292..2772906 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
P5F89_RS15615 (2772896) | 2772896..2774887 | - | 1992 | Protein_2631 | cytochrome o ubiquinol oxidase subunit I | - |
P5F89_RS15620 (2774909) | 2774909..2775406 | - | 498 | Protein_2632 | COX aromatic rich motif-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 2769482..2769985 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 16623.52 Da Isoelectric Point: 9.9538
>T276096 WP_014532172.1 NZ_CP121223:c2770494-2770033 [Shigella flexneri 2a]
MIAVTLLSINLYALRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLERQRVSGVLQGSQPSEIGVVRLVMLGGAR
KYQKRGFGQDLLCDFFEHVKKIHPALPIKGVYLDADPAAINFYARLGFVQLSATPNAFGAVPMFLAIQHILAA
MIAVTLLSINLYALRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLERQRVSGVLQGSQPSEIGVVRLVMLGGAR
KYQKRGFGQDLLCDFFEHVKKIHPALPIKGVYLDADPAAINFYARLGFVQLSATPNAFGAVPMFLAIQHILAA
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|