Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 2687814..2688508 | Replicon | chromosome |
| Accession | NZ_CP121223 | ||
| Organism | Shigella flexneri 2a strain Sflex 21-42 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q0T7Q5 |
| Locus tag | P5F89_RS15180 | Protein ID | WP_001263491.1 |
| Coordinates | 2688110..2688508 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | Q0T7Q4 |
| Locus tag | P5F89_RS15175 | Protein ID | WP_000554759.1 |
| Coordinates | 2687814..2688107 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5F89_RS15155 (2683453) | 2683453..2683950 | + | 498 | WP_000006251.1 | REP-associated tyrosine transposase RayT | - |
| P5F89_RS15160 (2684167) | 2684167..2685879 | - | 1713 | Protein_2541 | flagellar biosynthesis protein FlhA | - |
| P5F89_RS15165 (2685851) | 2685851..2686636 | + | 786 | WP_000207560.1 | putative lateral flagellar export/assembly protein LafU | - |
| P5F89_RS15170 (2686707) | 2686707..2687762 | + | 1056 | WP_001226172.1 | DNA polymerase IV | - |
| P5F89_RS15175 (2687814) | 2687814..2688107 | + | 294 | WP_000554759.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| P5F89_RS15180 (2688110) | 2688110..2688508 | + | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| P5F89_RS15185 (2688518) | 2688518..2688970 | + | 453 | WP_001059860.1 | GNAT family N-acetyltransferase | - |
| P5F89_RS15190 (2689216) | 2689216..2690259 | + | 1044 | WP_005053205.1 | RNA ligase RtcB family protein | - |
| P5F89_RS15195 (2690375) | 2690375..2690935 | + | 561 | Protein_2548 | peptide chain release factor H | - |
| P5F89_RS15200 (2690992) | 2690992..2692449 | - | 1458 | WP_001293030.1 | cytosol nonspecific dipeptidase | - |
| P5F89_RS15205 (2692711) | 2692711..2693169 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T276095 WP_001263491.1 NZ_CP121223:2688110-2688508 [Shigella flexneri 2a]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TPK7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TR46 |