Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 996157..996884 | Replicon | chromosome |
Accession | NZ_CP121223 | ||
Organism | Shigella flexneri 2a strain Sflex 21-42 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | P5F89_RS06885 | Protein ID | WP_000550189.1 |
Coordinates | 996570..996884 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | P5F89_RS06880 | Protein ID | WP_000560266.1 |
Coordinates | 996157..996573 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5F89_RS06870 (991517) | 991517..993868 | + | 2352 | WP_000695506.1 | alpha-glucosidase | - |
P5F89_RS06875 (994094) | 994094..996112 | + | 2019 | WP_000121487.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
P5F89_RS06880 (996157) | 996157..996573 | - | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
P5F89_RS06885 (996570) | 996570..996884 | - | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
P5F89_RS06890 (997169) | 997169..998305 | - | 1137 | WP_000018656.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
P5F89_RS06895 (998390) | 998390..998893 | + | 504 | WP_005050988.1 | M48 family metallopeptidase | - |
P5F89_RS06900 (998970) | 998970..999662 | + | 693 | WP_000942538.1 | vancomycin high temperature exclusion protein | - |
P5F89_RS06905 (999741) | 999741..1000739 | + | 999 | WP_005050984.1 | Gfo/Idh/MocA family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T276093 WP_000550189.1 NZ_CP121223:c996884-996570 [Shigella flexneri 2a]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT276093 WP_000560266.1 NZ_CP121223:c996573-996157 [Shigella flexneri 2a]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|