Detailed information of TA system TA276085

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 56913..57182
• Replicon: plasmid unnamed4
• Accession: NZ_CP121221
• Organism: Shigella flexneri 2a strain Sflex 21-42

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: P5F89_RS00480
• Protein ID: WP_001372321.1
• Coordinates: 57057..57182 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	56913..56978 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
P5F89_RS00440	51943..52380	-	438	Protein_72	hypothetical protein	-
P5F89_RS00445	52682..53209	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
P5F89_RS00450	53267..53500	+	234	WP_000006003.1	DUF905 family protein	-
P5F89_RS00455	53561..55525	+	1965	WP_001537566.1	ParB/RepB/Spo0J family partition protein	-
P5F89_RS00460	55594..56028	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
P5F89_RS00465	56025..56744	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	56756..56980	+	225	NuclAT_0	-	-
-	56756..56980	+	225	NuclAT_0	-	-
-	56756..56980	+	225	NuclAT_0	-	-
-	56756..56980	+	225	NuclAT_0	-	-
P5F89_RS00470	56765..56944	-	180	WP_001309233.1	hypothetical protein	-
-	56913..56978	-	66	-	-	Antitoxin
P5F89_RS00475	56966..57115	+	150	Protein_79	plasmid maintenance protein Mok	-
P5F89_RS00480	57057..57182	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
P5F89_RS00485	57483..57779	-	297	Protein_81	hypothetical protein	-
P5F89_RS00490	58079..58375	+	297	WP_001272251.1	hypothetical protein	-
P5F89_RS00495	58485..59306	+	822	WP_001234445.1	DUF932 domain-containing protein	-
P5F89_RS00500	59602..60111	-	510	WP_000759173.1	transglycosylase SLT domain-containing protein	-
P5F89_RS00505	60525..60908	+	384	WP_001151538.1	conjugal transfer relaxosome DNA-binding protein TraM	-
P5F89_RS00510	61095..61784	+	690	WP_000283387.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	aph(6)-Id / aph(3'')-Ib / sul2 / tet(A) / blaOXA-1 / aac(6')-Ib-cr	-	1..96218	96218

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T276085 WP_001372321.1 NZ_CP121221:57057-57182 [Shigella flexneri 2a]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT276085 NZ_CP121221:c56978-56913 [Shigella flexneri 2a]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin