Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2940..3193 | Replicon | plasmid unnamed4 |
| Accession | NZ_CP121221 | ||
| Organism | Shigella flexneri 2a strain Sflex 21-42 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A148HBD8 |
| Locus tag | P5F89_RS00105 | Protein ID | WP_001336447.1 |
| Coordinates | 3044..3193 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 2940..2996 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5F89_RS00085 (352) | 352..555 | + | 204 | WP_001336517.1 | hypothetical protein | - |
| P5F89_RS00090 (1308) | 1308..1769 | + | 462 | WP_000760080.1 | thermonuclease family protein | - |
| P5F89_RS00095 (1872) | 1872..2255 | + | 384 | WP_001109264.1 | hypothetical protein | - |
| P5F89_RS00100 (2408) | 2408..2845 | + | 438 | WP_000872609.1 | hypothetical protein | - |
| - (2940) | 2940..2996 | - | 57 | NuclAT_1 | - | Antitoxin |
| - (2940) | 2940..2996 | - | 57 | NuclAT_1 | - | Antitoxin |
| - (2940) | 2940..2996 | - | 57 | NuclAT_1 | - | Antitoxin |
| - (2940) | 2940..2996 | - | 57 | NuclAT_1 | - | Antitoxin |
| P5F89_RS00105 (3044) | 3044..3193 | + | 150 | WP_001336447.1 | Hok/Gef family protein | Toxin |
| P5F89_RS00110 (3478) | 3478..3735 | + | 258 | WP_000084404.1 | replication regulatory protein RepA | - |
| P5F89_RS00115 (3969) | 3969..4043 | + | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| P5F89_RS00120 (4036) | 4036..4893 | + | 858 | WP_001537577.1 | incFII family plasmid replication initiator RepA | - |
| P5F89_RS00125 (5594) | 5594..5734 | + | 141 | WP_021503378.1 | hypothetical protein | - |
| P5F89_RS00130 (5807) | 5807..6076 | + | 270 | WP_000079939.1 | type II toxin-antitoxin system antitoxin YacA | - |
| P5F89_RS00135 (6076) | 6076..6186 | + | 111 | Protein_11 | type II toxin-antitoxin system toxin YacB | - |
| P5F89_RS00140 (6285) | 6285..7208 | + | 924 | WP_001415483.1 | hypothetical protein | - |
| P5F89_RS00145 (7650) | 7650..8030 | + | 381 | WP_001696636.1 | HTH domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(6)-Id / aph(3'')-Ib / sul2 / tet(A) / blaOXA-1 / aac(6')-Ib-cr | - | 1..96218 | 96218 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5572.69 Da Isoelectric Point: 8.7678
>T276081 WP_001336447.1 NZ_CP121221:3044-3193 [Shigella flexneri 2a]
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 57 bp
>AT276081 NZ_CP121221:c2996-2940 [Shigella flexneri 2a]
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|