Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2622040..2622224 | Replicon | chromosome |
Accession | NZ_CP121204 | ||
Organism | Staphylococcus aureus strain SA0907 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | P7F77_RS13280 | Protein ID | WP_000482647.1 |
Coordinates | 2622117..2622224 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2622040..2622100 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7F77_RS13265 | 2617550..2617717 | - | 168 | WP_031875065.1 | hypothetical protein | - |
P7F77_RS13270 | 2617948..2619681 | - | 1734 | WP_000488491.1 | ABC transporter ATP-binding protein | - |
P7F77_RS13275 | 2619730..2621469 | - | 1740 | WP_001064832.1 | ABC transporter ATP-binding protein | - |
- | 2622040..2622100 | + | 61 | - | - | Antitoxin |
P7F77_RS13280 | 2622117..2622224 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
P7F77_RS13285 | 2622358..2622744 | - | 387 | WP_000779354.1 | flippase GtxA | - |
P7F77_RS13290 | 2623012..2624154 | + | 1143 | WP_031875064.1 | glycerate kinase | - |
P7F77_RS13295 | 2624214..2624873 | + | 660 | WP_000831298.1 | membrane protein | - |
P7F77_RS13300 | 2625053..2626264 | + | 1212 | WP_001191975.1 | multidrug effflux MFS transporter | - |
P7F77_RS13305 | 2626387..2626860 | - | 474 | WP_000456490.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T276078 WP_000482647.1 NZ_CP121204:c2622224-2622117 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT276078 NZ_CP121204:2622040-2622100 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|