Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 2102002..2102309 | Replicon | chromosome |
| Accession | NZ_CP121204 | ||
| Organism | Staphylococcus aureus strain SA0907 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | P7F77_RS10435 | Protein ID | WP_011447039.1 |
| Coordinates | 2102133..2102309 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 2102002..2102141 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7F77_RS10395 (2097341) | 2097341..2097601 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| P7F77_RS10400 (2097654) | 2097654..2098004 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| P7F77_RS10405 (2098689) | 2098689..2099138 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| P7F77_RS10410 (2099233) | 2099233..2099568 | - | 336 | Protein_2012 | SH3 domain-containing protein | - |
| P7F77_RS10415 (2100218) | 2100218..2100709 | - | 492 | WP_000919350.1 | staphylokinase | - |
| P7F77_RS10420 (2100900) | 2100900..2101655 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| P7F77_RS10425 (2101667) | 2101667..2101921 | - | 255 | WP_000611512.1 | phage holin | - |
| P7F77_RS10430 (2101973) | 2101973..2102080 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - (2102002) | 2102002..2102141 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (2102002) | 2102002..2102141 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (2102002) | 2102002..2102141 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (2102002) | 2102002..2102141 | + | 140 | NuclAT_0 | - | Antitoxin |
| P7F77_RS10435 (2102133) | 2102133..2102309 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| P7F77_RS10440 (2102459) | 2102459..2102755 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| P7F77_RS10445 (2102813) | 2102813..2103100 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| P7F77_RS10450 (2103147) | 2103147..2103299 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| P7F77_RS10455 (2103289) | 2103289..2107074 | - | 3786 | WP_000582165.1 | phage tail spike protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / chp / sak | 2097654..2140691 | 43037 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T276072 WP_011447039.1 NZ_CP121204:c2102309-2102133 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT276072 NZ_CP121204:2102002-2102141 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
