Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4806365..4807119 | Replicon | chromosome |
| Accession | NZ_CP121189 | ||
| Organism | Salmonella enterica subsp. enterica serovar Indiana strain S1467 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A4Y6MJG6 |
| Locus tag | P6164_RS23315 | Protein ID | WP_000558165.1 |
| Coordinates | 4806365..4806676 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P6164_RS23320 | Protein ID | WP_001259009.1 |
| Coordinates | 4806673..4807119 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6164_RS23285 (4802031) | 4802031..4802933 | + | 903 | WP_051129234.1 | formate dehydrogenase subunit beta | - |
| P6164_RS23290 (4802930) | 4802930..4803565 | + | 636 | WP_000829028.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P6164_RS23295 (4803562) | 4803562..4804491 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| P6164_RS23300 (4804529) | 4804529..4804903 | - | 375 | WP_000238494.1 | type II toxin-antitoxin system VapC family toxin | - |
| P6164_RS23305 (4804903) | 4804903..4805145 | - | 243 | WP_001523745.1 | CopG family transcriptional regulator | - |
| P6164_RS23310 (4805350) | 4805350..4806279 | + | 930 | WP_001162861.1 | alpha/beta hydrolase | - |
| P6164_RS23315 (4806365) | 4806365..4806676 | + | 312 | WP_000558165.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| P6164_RS23320 (4806673) | 4806673..4807119 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| P6164_RS23325 (4807134) | 4807134..4808075 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| P6164_RS23330 (4808120) | 4808120..4808557 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| P6164_RS23335 (4808554) | 4808554..4809426 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| P6164_RS23340 (4809420) | 4809420..4810019 | - | 600 | WP_023227076.1 | glucose-1-phosphatase | - |
| P6164_RS23345 (4810210) | 4810210..4811013 | - | 804 | WP_000059689.1 | DeoR family transcriptional regulator | - |
| P6164_RS23350 (4811047) | 4811047..4811943 | - | 897 | WP_023227075.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12433.34 Da Isoelectric Point: 8.4020
>T276029 WP_000558165.1 NZ_CP121189:4806365-4806676 [Salmonella enterica subsp. enterica serovar Indiana]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT276029 WP_001259009.1 NZ_CP121189:4806673-4807119 [Salmonella enterica subsp. enterica serovar Indiana]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|