Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 2982464..2983299 | Replicon | chromosome |
Accession | NZ_CP121189 | ||
Organism | Salmonella enterica subsp. enterica serovar Indiana strain S1467 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A7W4PV54 |
Locus tag | P6164_RS14730 | Protein ID | WP_000854821.1 |
Coordinates | 2982464..2982841 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A6H2GGB7 |
Locus tag | P6164_RS14735 | Protein ID | WP_001285390.1 |
Coordinates | 2982931..2983299 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6164_RS14690 (2977724) | 2977724..2978206 | - | 483 | WP_001546652.1 | DUF1097 domain-containing protein | - |
P6164_RS14695 (2978307) | 2978307..2978861 | - | 555 | WP_001001883.1 | molecular chaperone | - |
P6164_RS14700 (2978885) | 2978885..2979622 | - | 738 | WP_000283643.1 | phosphatase | - |
P6164_RS14705 (2979707) | 2979707..2980645 | - | 939 | WP_000402552.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
P6164_RS14715 (2981118) | 2981118..2981960 | - | 843 | WP_072643849.1 | DUF4942 domain-containing protein | - |
P6164_RS14720 (2982045) | 2982045..2982242 | - | 198 | WP_023563519.1 | DUF957 domain-containing protein | - |
P6164_RS14725 (2982270) | 2982270..2982467 | - | 198 | Protein_2888 | DUF5983 family protein | - |
P6164_RS14730 (2982464) | 2982464..2982841 | - | 378 | WP_000854821.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
P6164_RS14735 (2982931) | 2982931..2983299 | - | 369 | WP_001285390.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
P6164_RS14740 (2983349) | 2983349..2983999 | - | 651 | WP_113387941.1 | antitoxin of toxin-antitoxin stability system | - |
P6164_RS14745 (2984012) | 2984012..2984233 | - | 222 | WP_001544501.1 | DUF987 domain-containing protein | - |
P6164_RS14750 (2984302) | 2984302..2984778 | - | 477 | WP_001186742.1 | RadC family protein | - |
P6164_RS14755 (2984793) | 2984793..2985278 | - | 486 | WP_113387942.1 | antirestriction protein | - |
P6164_RS14760 (2985369) | 2985369..2986187 | - | 819 | WP_001234702.1 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 2977158..2977616 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13930.95 Da Isoelectric Point: 8.5163
>T276022 WP_000854821.1 NZ_CP121189:c2982841-2982464 [Salmonella enterica subsp. enterica serovar Indiana]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13811.52 Da Isoelectric Point: 5.9618
>AT276022 WP_001285390.1 NZ_CP121189:c2983299-2982931 [Salmonella enterica subsp. enterica serovar Indiana]
VSDTFHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTFHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7W4PV54 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6H2GGB7 |