Detailed information of TA system TA275998

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 30877..31303
• Replicon: plasmid pE89-1
• Accession: NZ_CP121158
• Organism: Escherichia coli strain E89

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: P6H86_RS23705
• Protein ID: WP_001372321.1
• Coordinates: 30877..31002 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	31079..31303 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
P6H86_RS23670 (25900)	25900..26127	-	228	WP_000089263.1	conjugal transfer relaxosome protein TraY	-
P6H86_RS23675 (26264)	26264..26935	-	672	WP_000283561.1	conjugal transfer transcriptional regulator TraJ	-
P6H86_RS23680 (27129)	27129..27512	-	384	WP_001354030.1	conjugal transfer relaxosome DNA-binding protein TraM	-
P6H86_RS23685 (27835)	27835..28437	+	603	WP_000243713.1	transglycosylase SLT domain-containing protein	-
P6H86_RS23690 (28734)	28734..29555	-	822	WP_001234445.1	DUF932 domain-containing protein	-
P6H86_RS23695 (29666)	29666..29962	-	297	WP_001272251.1	hypothetical protein	-
P6H86_RS23700 (30262)	30262..30558	+	297	Protein_37	hypothetical protein	-
P6H86_RS23705 (30877)	30877..31002	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
P6H86_RS23710 (30944)	30944..31093	-	150	Protein_39	plasmid maintenance protein Mok	-
P6H86_RS23715 (31115)	31115..31294	+	180	WP_001309233.1	hypothetical protein	-
- (31079)	31079..31303	-	225	NuclAT_0	-	Antitoxin
- (31079)	31079..31303	-	225	NuclAT_0	-	Antitoxin
- (31079)	31079..31303	-	225	NuclAT_0	-	Antitoxin
- (31079)	31079..31303	-	225	NuclAT_0	-	Antitoxin
P6H86_RS23720 (31272)	31272..32034	-	763	Protein_41	plasmid SOS inhibition protein A	-
P6H86_RS23725 (32031)	32031..32465	-	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
P6H86_RS23730 (32534)	32534..34557	-	2024	Protein_43	ParB/RepB/Spo0J family partition protein	-
P6H86_RS23735 (34618)	34618..34851	-	234	WP_000006003.1	DUF905 family protein	-
P6H86_RS23740 (34909)	34909..35436	-	528	WP_000290834.1	single-stranded DNA-binding protein	-
P6H86_RS23745 (35738)	35738..36187	+	450	Protein_46	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	erm(42) / ant(3'')-Ia / sitABCD / fosA3 / blaTEM-1B / blaCTX-M-55 / aac(3)-IId / mph(A)	iutA / iucD / iucC / iucB / iucA	1..159910	159910

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T275998 WP_001372321.1 NZ_CP121158:c31002-30877 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT275998 NZ_CP121158:c31303-31079 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin