Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 30877..31303 | Replicon | plasmid pE89-1 |
| Accession | NZ_CP121158 | ||
| Organism | Escherichia coli strain E89 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | P6H86_RS23705 | Protein ID | WP_001372321.1 |
| Coordinates | 30877..31002 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 31079..31303 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6H86_RS23670 (25900) | 25900..26127 | - | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
| P6H86_RS23675 (26264) | 26264..26935 | - | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| P6H86_RS23680 (27129) | 27129..27512 | - | 384 | WP_001354030.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| P6H86_RS23685 (27835) | 27835..28437 | + | 603 | WP_000243713.1 | transglycosylase SLT domain-containing protein | - |
| P6H86_RS23690 (28734) | 28734..29555 | - | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| P6H86_RS23695 (29666) | 29666..29962 | - | 297 | WP_001272251.1 | hypothetical protein | - |
| P6H86_RS23700 (30262) | 30262..30558 | + | 297 | Protein_37 | hypothetical protein | - |
| P6H86_RS23705 (30877) | 30877..31002 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| P6H86_RS23710 (30944) | 30944..31093 | - | 150 | Protein_39 | plasmid maintenance protein Mok | - |
| P6H86_RS23715 (31115) | 31115..31294 | + | 180 | WP_001309233.1 | hypothetical protein | - |
| - (31079) | 31079..31303 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (31079) | 31079..31303 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (31079) | 31079..31303 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (31079) | 31079..31303 | - | 225 | NuclAT_0 | - | Antitoxin |
| P6H86_RS23720 (31272) | 31272..32034 | - | 763 | Protein_41 | plasmid SOS inhibition protein A | - |
| P6H86_RS23725 (32031) | 32031..32465 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| P6H86_RS23730 (32534) | 32534..34557 | - | 2024 | Protein_43 | ParB/RepB/Spo0J family partition protein | - |
| P6H86_RS23735 (34618) | 34618..34851 | - | 234 | WP_000006003.1 | DUF905 family protein | - |
| P6H86_RS23740 (34909) | 34909..35436 | - | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| P6H86_RS23745 (35738) | 35738..36187 | + | 450 | Protein_46 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | erm(42) / ant(3'')-Ia / sitABCD / fosA3 / blaTEM-1B / blaCTX-M-55 / aac(3)-IId / mph(A) | iutA / iucD / iucC / iucB / iucA | 1..159910 | 159910 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T275998 WP_001372321.1 NZ_CP121158:c31002-30877 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT275998 NZ_CP121158:c31303-31079 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|