Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 2146365..2146736 | Replicon | chromosome |
| Accession | NZ_CP121157 | ||
| Organism | Escherichia coli strain E89 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | F4VC37 |
| Locus tag | P6H86_RS10565 | Protein ID | WP_001317028.1 |
| Coordinates | 2146542..2146736 (-) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 2146365..2146543 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6H86_RS10535 (2142117) | 2142117..2142290 | + | 174 | WP_001296046.1 | protein YnaL | - |
| P6H86_RS10540 (2142320) | 2142320..2143693 | + | 1374 | WP_000123737.1 | ATP-dependent RNA helicase DbpA | - |
| P6H86_RS10545 (2143822) | 2143822..2144757 | - | 936 | WP_001157406.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| P6H86_RS10550 (2144809) | 2144809..2146044 | - | 1236 | WP_000040852.1 | site-specific integrase | - |
| P6H86_RS10555 (2146046) | 2146046..2146261 | - | 216 | WP_000079604.1 | excisionase XisR | - |
| - (2146365) | 2146365..2146543 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2146365) | 2146365..2146543 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2146365) | 2146365..2146543 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2146365) | 2146365..2146543 | + | 179 | NuclAT_0 | - | Antitoxin |
| P6H86_RS10560 (2146340) | 2146340..2146549 | - | 210 | WP_000276809.1 | double-strand break reduction protein RcbA | - |
| P6H86_RS10565 (2146542) | 2146542..2146736 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| P6H86_RS10570 (2146793) | 2146793..2147602 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
| P6H86_RS10575 (2147595) | 2147595..2150195 | - | 2601 | WP_000105124.1 | exodeoxyribonuclease VIII | - |
| P6H86_RS10580 (2150297) | 2150297..2150572 | - | 276 | WP_000632297.1 | protein RacC | - |
| P6H86_RS10585 (2150646) | 2150646..2150816 | - | 171 | WP_001352098.1 | YdaE family protein | - |
| P6H86_RS10590 (2150816) | 2150816..2151037 | - | 222 | WP_000560223.1 | killing protein KilR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2144809..2171123 | 26314 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T275985 WP_001317028.1 NZ_CP121157:c2146736-2146542 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT275985 NZ_CP121157:2146365-2146543 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|