Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 2004143..2004365 Replicon chromosome
Accession NZ_CP121157
Organism Escherichia coli strain E89

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag P6H86_RS09805 Protein ID WP_000170955.1
Coordinates 2004143..2004250 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 2004298..2004365 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P6H86_RS09775 (1999452) 1999452..2000534 + 1083 WP_000804726.1 peptide chain release factor 1 -
P6H86_RS09780 (2000534) 2000534..2001367 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
P6H86_RS09785 (2001364) 2001364..2001756 + 393 WP_000200374.1 invasion regulator SirB2 -
P6H86_RS09790 (2001760) 2001760..2002569 + 810 WP_001257044.1 invasion regulator SirB1 -
P6H86_RS09795 (2002605) 2002605..2003459 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
P6H86_RS09800 (2003608) 2003608..2003715 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2003763) 2003763..2003829 + 67 NuclAT_27 - -
- (2003763) 2003763..2003829 + 67 NuclAT_27 - -
- (2003763) 2003763..2003829 + 67 NuclAT_27 - -
- (2003763) 2003763..2003829 + 67 NuclAT_27 - -
- (2003763) 2003763..2003829 + 67 NuclAT_28 - -
- (2003763) 2003763..2003829 + 67 NuclAT_28 - -
- (2003763) 2003763..2003829 + 67 NuclAT_28 - -
- (2003763) 2003763..2003829 + 67 NuclAT_28 - -
- (2003763) 2003763..2003829 + 67 NuclAT_29 - -
- (2003763) 2003763..2003829 + 67 NuclAT_29 - -
- (2003763) 2003763..2003829 + 67 NuclAT_29 - -
- (2003763) 2003763..2003829 + 67 NuclAT_29 - -
- (2003763) 2003763..2003829 + 67 NuclAT_30 - -
- (2003763) 2003763..2003829 + 67 NuclAT_30 - -
- (2003763) 2003763..2003829 + 67 NuclAT_30 - -
- (2003763) 2003763..2003829 + 67 NuclAT_30 - -
- (2003763) 2003763..2003829 + 67 NuclAT_31 - -
- (2003763) 2003763..2003829 + 67 NuclAT_31 - -
- (2003763) 2003763..2003829 + 67 NuclAT_31 - -
- (2003763) 2003763..2003829 + 67 NuclAT_31 - -
- (2003763) 2003763..2003829 + 67 NuclAT_32 - -
- (2003763) 2003763..2003829 + 67 NuclAT_32 - -
- (2003763) 2003763..2003829 + 67 NuclAT_32 - -
- (2003763) 2003763..2003829 + 67 NuclAT_32 - -
- (2003765) 2003765..2003830 + 66 NuclAT_16 - -
- (2003765) 2003765..2003830 + 66 NuclAT_16 - -
- (2003765) 2003765..2003830 + 66 NuclAT_16 - -
- (2003765) 2003765..2003830 + 66 NuclAT_16 - -
- (2003765) 2003765..2003830 + 66 NuclAT_18 - -
- (2003765) 2003765..2003830 + 66 NuclAT_18 - -
- (2003765) 2003765..2003830 + 66 NuclAT_18 - -
- (2003765) 2003765..2003830 + 66 NuclAT_18 - -
- (2003765) 2003765..2003830 + 66 NuclAT_20 - -
- (2003765) 2003765..2003830 + 66 NuclAT_20 - -
- (2003765) 2003765..2003830 + 66 NuclAT_20 - -
- (2003765) 2003765..2003830 + 66 NuclAT_20 - -
- (2003765) 2003765..2003830 + 66 NuclAT_22 - -
- (2003765) 2003765..2003830 + 66 NuclAT_22 - -
- (2003765) 2003765..2003830 + 66 NuclAT_22 - -
- (2003765) 2003765..2003830 + 66 NuclAT_22 - -
- (2003765) 2003765..2003830 + 66 NuclAT_24 - -
- (2003765) 2003765..2003830 + 66 NuclAT_24 - -
- (2003765) 2003765..2003830 + 66 NuclAT_24 - -
- (2003765) 2003765..2003830 + 66 NuclAT_24 - -
- (2003765) 2003765..2003830 + 66 NuclAT_26 - -
- (2003765) 2003765..2003830 + 66 NuclAT_26 - -
- (2003765) 2003765..2003830 + 66 NuclAT_26 - -
- (2003765) 2003765..2003830 + 66 NuclAT_26 - -
P6H86_RS09805 (2004143) 2004143..2004250 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2004298) 2004298..2004365 + 68 NuclAT_15 - Antitoxin
- (2004298) 2004298..2004365 + 68 NuclAT_15 - Antitoxin
- (2004298) 2004298..2004365 + 68 NuclAT_15 - Antitoxin
- (2004298) 2004298..2004365 + 68 NuclAT_15 - Antitoxin
- (2004298) 2004298..2004365 + 68 NuclAT_17 - Antitoxin
- (2004298) 2004298..2004365 + 68 NuclAT_17 - Antitoxin
- (2004298) 2004298..2004365 + 68 NuclAT_17 - Antitoxin
- (2004298) 2004298..2004365 + 68 NuclAT_17 - Antitoxin
- (2004298) 2004298..2004365 + 68 NuclAT_19 - Antitoxin
- (2004298) 2004298..2004365 + 68 NuclAT_19 - Antitoxin
- (2004298) 2004298..2004365 + 68 NuclAT_19 - Antitoxin
- (2004298) 2004298..2004365 + 68 NuclAT_19 - Antitoxin
- (2004298) 2004298..2004365 + 68 NuclAT_21 - Antitoxin
- (2004298) 2004298..2004365 + 68 NuclAT_21 - Antitoxin
- (2004298) 2004298..2004365 + 68 NuclAT_21 - Antitoxin
- (2004298) 2004298..2004365 + 68 NuclAT_21 - Antitoxin
- (2004298) 2004298..2004365 + 68 NuclAT_23 - Antitoxin
- (2004298) 2004298..2004365 + 68 NuclAT_23 - Antitoxin
- (2004298) 2004298..2004365 + 68 NuclAT_23 - Antitoxin
- (2004298) 2004298..2004365 + 68 NuclAT_23 - Antitoxin
- (2004298) 2004298..2004365 + 68 NuclAT_25 - Antitoxin
- (2004298) 2004298..2004365 + 68 NuclAT_25 - Antitoxin
- (2004298) 2004298..2004365 + 68 NuclAT_25 - Antitoxin
- (2004298) 2004298..2004365 + 68 NuclAT_25 - Antitoxin
P6H86_RS09810 (2004654) 2004654..2005754 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
P6H86_RS09815 (2006024) 2006024..2006254 + 231 WP_001146444.1 putative cation transport regulator ChaB -
P6H86_RS09820 (2006412) 2006412..2007107 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
P6H86_RS09825 (2007151) 2007151..2007504 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
P6H86_RS09830 (2007689) 2007689..2009083 + 1395 WP_000086217.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T275981 WP_000170955.1 NZ_CP121157:c2004250-2004143 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 68 bp

>AT275981 NZ_CP121157:2004298-2004365 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829J2A9

Antitoxin

Download structure file

References