Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
| Location | 2004143..2004365 | Replicon | chromosome |
| Accession | NZ_CP121157 | ||
| Organism | Escherichia coli strain E89 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | D3H2K1 |
| Locus tag | P6H86_RS09805 | Protein ID | WP_000170955.1 |
| Coordinates | 2004143..2004250 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 2004298..2004365 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6H86_RS09775 (1999452) | 1999452..2000534 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| P6H86_RS09780 (2000534) | 2000534..2001367 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| P6H86_RS09785 (2001364) | 2001364..2001756 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| P6H86_RS09790 (2001760) | 2001760..2002569 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| P6H86_RS09795 (2002605) | 2002605..2003459 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| P6H86_RS09800 (2003608) | 2003608..2003715 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (2003763) | 2003763..2003829 | + | 67 | NuclAT_27 | - | - |
| - (2003763) | 2003763..2003829 | + | 67 | NuclAT_27 | - | - |
| - (2003763) | 2003763..2003829 | + | 67 | NuclAT_27 | - | - |
| - (2003763) | 2003763..2003829 | + | 67 | NuclAT_27 | - | - |
| - (2003763) | 2003763..2003829 | + | 67 | NuclAT_28 | - | - |
| - (2003763) | 2003763..2003829 | + | 67 | NuclAT_28 | - | - |
| - (2003763) | 2003763..2003829 | + | 67 | NuclAT_28 | - | - |
| - (2003763) | 2003763..2003829 | + | 67 | NuclAT_28 | - | - |
| - (2003763) | 2003763..2003829 | + | 67 | NuclAT_29 | - | - |
| - (2003763) | 2003763..2003829 | + | 67 | NuclAT_29 | - | - |
| - (2003763) | 2003763..2003829 | + | 67 | NuclAT_29 | - | - |
| - (2003763) | 2003763..2003829 | + | 67 | NuclAT_29 | - | - |
| - (2003763) | 2003763..2003829 | + | 67 | NuclAT_30 | - | - |
| - (2003763) | 2003763..2003829 | + | 67 | NuclAT_30 | - | - |
| - (2003763) | 2003763..2003829 | + | 67 | NuclAT_30 | - | - |
| - (2003763) | 2003763..2003829 | + | 67 | NuclAT_30 | - | - |
| - (2003763) | 2003763..2003829 | + | 67 | NuclAT_31 | - | - |
| - (2003763) | 2003763..2003829 | + | 67 | NuclAT_31 | - | - |
| - (2003763) | 2003763..2003829 | + | 67 | NuclAT_31 | - | - |
| - (2003763) | 2003763..2003829 | + | 67 | NuclAT_31 | - | - |
| - (2003763) | 2003763..2003829 | + | 67 | NuclAT_32 | - | - |
| - (2003763) | 2003763..2003829 | + | 67 | NuclAT_32 | - | - |
| - (2003763) | 2003763..2003829 | + | 67 | NuclAT_32 | - | - |
| - (2003763) | 2003763..2003829 | + | 67 | NuclAT_32 | - | - |
| - (2003765) | 2003765..2003830 | + | 66 | NuclAT_16 | - | - |
| - (2003765) | 2003765..2003830 | + | 66 | NuclAT_16 | - | - |
| - (2003765) | 2003765..2003830 | + | 66 | NuclAT_16 | - | - |
| - (2003765) | 2003765..2003830 | + | 66 | NuclAT_16 | - | - |
| - (2003765) | 2003765..2003830 | + | 66 | NuclAT_18 | - | - |
| - (2003765) | 2003765..2003830 | + | 66 | NuclAT_18 | - | - |
| - (2003765) | 2003765..2003830 | + | 66 | NuclAT_18 | - | - |
| - (2003765) | 2003765..2003830 | + | 66 | NuclAT_18 | - | - |
| - (2003765) | 2003765..2003830 | + | 66 | NuclAT_20 | - | - |
| - (2003765) | 2003765..2003830 | + | 66 | NuclAT_20 | - | - |
| - (2003765) | 2003765..2003830 | + | 66 | NuclAT_20 | - | - |
| - (2003765) | 2003765..2003830 | + | 66 | NuclAT_20 | - | - |
| - (2003765) | 2003765..2003830 | + | 66 | NuclAT_22 | - | - |
| - (2003765) | 2003765..2003830 | + | 66 | NuclAT_22 | - | - |
| - (2003765) | 2003765..2003830 | + | 66 | NuclAT_22 | - | - |
| - (2003765) | 2003765..2003830 | + | 66 | NuclAT_22 | - | - |
| - (2003765) | 2003765..2003830 | + | 66 | NuclAT_24 | - | - |
| - (2003765) | 2003765..2003830 | + | 66 | NuclAT_24 | - | - |
| - (2003765) | 2003765..2003830 | + | 66 | NuclAT_24 | - | - |
| - (2003765) | 2003765..2003830 | + | 66 | NuclAT_24 | - | - |
| - (2003765) | 2003765..2003830 | + | 66 | NuclAT_26 | - | - |
| - (2003765) | 2003765..2003830 | + | 66 | NuclAT_26 | - | - |
| - (2003765) | 2003765..2003830 | + | 66 | NuclAT_26 | - | - |
| - (2003765) | 2003765..2003830 | + | 66 | NuclAT_26 | - | - |
| P6H86_RS09805 (2004143) | 2004143..2004250 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (2004298) | 2004298..2004365 | + | 68 | NuclAT_15 | - | Antitoxin |
| - (2004298) | 2004298..2004365 | + | 68 | NuclAT_15 | - | Antitoxin |
| - (2004298) | 2004298..2004365 | + | 68 | NuclAT_15 | - | Antitoxin |
| - (2004298) | 2004298..2004365 | + | 68 | NuclAT_15 | - | Antitoxin |
| - (2004298) | 2004298..2004365 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (2004298) | 2004298..2004365 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (2004298) | 2004298..2004365 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (2004298) | 2004298..2004365 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (2004298) | 2004298..2004365 | + | 68 | NuclAT_19 | - | Antitoxin |
| - (2004298) | 2004298..2004365 | + | 68 | NuclAT_19 | - | Antitoxin |
| - (2004298) | 2004298..2004365 | + | 68 | NuclAT_19 | - | Antitoxin |
| - (2004298) | 2004298..2004365 | + | 68 | NuclAT_19 | - | Antitoxin |
| - (2004298) | 2004298..2004365 | + | 68 | NuclAT_21 | - | Antitoxin |
| - (2004298) | 2004298..2004365 | + | 68 | NuclAT_21 | - | Antitoxin |
| - (2004298) | 2004298..2004365 | + | 68 | NuclAT_21 | - | Antitoxin |
| - (2004298) | 2004298..2004365 | + | 68 | NuclAT_21 | - | Antitoxin |
| - (2004298) | 2004298..2004365 | + | 68 | NuclAT_23 | - | Antitoxin |
| - (2004298) | 2004298..2004365 | + | 68 | NuclAT_23 | - | Antitoxin |
| - (2004298) | 2004298..2004365 | + | 68 | NuclAT_23 | - | Antitoxin |
| - (2004298) | 2004298..2004365 | + | 68 | NuclAT_23 | - | Antitoxin |
| - (2004298) | 2004298..2004365 | + | 68 | NuclAT_25 | - | Antitoxin |
| - (2004298) | 2004298..2004365 | + | 68 | NuclAT_25 | - | Antitoxin |
| - (2004298) | 2004298..2004365 | + | 68 | NuclAT_25 | - | Antitoxin |
| - (2004298) | 2004298..2004365 | + | 68 | NuclAT_25 | - | Antitoxin |
| P6H86_RS09810 (2004654) | 2004654..2005754 | - | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
| P6H86_RS09815 (2006024) | 2006024..2006254 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| P6H86_RS09820 (2006412) | 2006412..2007107 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| P6H86_RS09825 (2007151) | 2007151..2007504 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| P6H86_RS09830 (2007689) | 2007689..2009083 | + | 1395 | WP_000086217.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4013.82 Da Isoelectric Point: 11.4779
>T275981 WP_000170955.1 NZ_CP121157:c2004250-2004143 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 68 bp
>AT275981 NZ_CP121157:2004298-2004365 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|