Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 79875..80108 | Replicon | plasmid pE67-1 |
| Accession | NZ_CP121156 | ||
| Organism | Escherichia coli strain E67 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | P6H85_RS24230 | Protein ID | WP_001372321.1 |
| Coordinates | 79983..80108 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 79875..79906 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6H85_RS24200 (75061) | 75061..77019 | + | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
| P6H85_RS24205 (77074) | 77074..77508 | + | 435 | WP_000845895.1 | conjugation system SOS inhibitor PsiB | - |
| P6H85_RS24210 (77505) | 77505..78267 | + | 763 | Protein_94 | plasmid SOS inhibition protein A | - |
| P6H85_RS24215 (78236) | 78236..78424 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - (78236) | 78236..78433 | + | 198 | NuclAT_0 | - | - |
| - (78236) | 78236..78433 | + | 198 | NuclAT_0 | - | - |
| - (78236) | 78236..78433 | + | 198 | NuclAT_0 | - | - |
| - (78236) | 78236..78433 | + | 198 | NuclAT_0 | - | - |
| P6H85_RS24220 (78481) | 78481..79850 | + | 1370 | WP_087522250.1 | IS3-like element IS150 family transposase | - |
| - (79875) | 79875..79906 | + | 32 | NuclAT_1 | - | Antitoxin |
| - (79875) | 79875..79906 | + | 32 | NuclAT_1 | - | Antitoxin |
| - (79875) | 79875..79906 | + | 32 | NuclAT_1 | - | Antitoxin |
| - (79875) | 79875..79906 | + | 32 | NuclAT_1 | - | Antitoxin |
| P6H85_RS24225 (79892) | 79892..80041 | + | 150 | Protein_97 | plasmid maintenance protein Mok | - |
| P6H85_RS24230 (79983) | 79983..80108 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| P6H85_RS24235 (80328) | 80328..80558 | + | 231 | WP_001426396.1 | hypothetical protein | - |
| P6H85_RS24240 (80556) | 80556..80729 | - | 174 | Protein_100 | hypothetical protein | - |
| P6H85_RS24245 (80799) | 80799..81005 | + | 207 | WP_000547939.1 | hypothetical protein | - |
| P6H85_RS24250 (81030) | 81030..81317 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| P6H85_RS24255 (81438) | 81438..82259 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| P6H85_RS24260 (82556) | 82556..83203 | - | 648 | WP_000614936.1 | transglycosylase SLT domain-containing protein | - |
| P6H85_RS24265 (83480) | 83480..83863 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| P6H85_RS24270 (84054) | 84054..84740 | + | 687 | WP_000332484.1 | PAS domain-containing protein | - |
| P6H85_RS24275 (84834) | 84834..85061 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-27 / aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aph(3')-Ia / tet(A) / mph(A) / dfrA14 | - | 1..124410 | 124410 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T275973 WP_001372321.1 NZ_CP121156:79983-80108 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 32 bp
>AT275973 NZ_CP121156:79875-79906 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
