Detailed information of TA system TA027597

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 79542..79796
• Replicon: plasmid pO83_CORR
• Accession: NC_017659
• Organism: Escherichia coli O83:H1 str. NRG 857C

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: -
• Locus tag: NRG857_RS23200
• Protein ID: WP_001351576.1
• Coordinates: 79542..79748 (-)
• Length: 69 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	79735..79796 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NRG857_RS23165	75093..75494	-	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
NRG857_RS23170	75427..75684	-	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
NRG857_RS23175	75777..76430	-	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
NRG857_RS23180	77370..78227	-	858	WP_000774303.1	incFII family plasmid replication initiator RepA	-
NRG857_RS23185	78220..78702	-	483	WP_001273588.1	hypothetical protein	-
NRG857_RS23190	78695..78769	-	75	WP_001442103.1	RepA leader peptide Tap	-
NRG857_RS23195	79001..79258	-	258	WP_000083845.1	replication regulatory protein RepA	-
NRG857_RS23200	79542..79748	-	207	WP_001351576.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	79735..79796	+	62	NuclAT_1	-	Antitoxin
-	79735..79796	+	62	NuclAT_1	-	Antitoxin
-	79735..79796	+	62	NuclAT_1	-	Antitoxin
-	79735..79796	+	62	NuclAT_1	-	Antitoxin
NRG857_RS23610	80052..80126	-	75	Protein_86	endonuclease	-
NRG857_RS23205	80372..80584	-	213	WP_001299730.1	ANR family transcriptional regulator	-
NRG857_RS23210	80720..81280	-	561	WP_000139315.1	fertility inhibition protein FinO	-
NRG857_RS23215	81383..82243	-	861	WP_000704527.1	alpha/beta hydrolase	-
NRG857_RS23220	82302..83048	-	747	WP_000205766.1	conjugal transfer pilus acetylase TraX	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(A) / catA1 / blaTEM-1B / sul2 / aph(3'')-Ib / aph(6)-Id / dfrA1 / ant(3'')-Ia / qacE / sul1 / mph(B) / sitABCD	iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA	1..147060	147060

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (23-64)

Sequences

Toxin

Protein

• Length: 69 a.a.
• Molecular weight: 7826.31 Da
• Isoelectric Point: 8.8807

>T27597 WP_001351576.1 NC_017659:c79748-79542 [Escherichia coli O83:H1 str. NRG 857C]
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 207 bp

>T27597 NC_017659:c79748-79542 [Escherichia coli O83:H1 str. NRG 857C]
ATGAAGTACCTTAACACTACTGATTGTAGCCTCTTCTTTGCTGAGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAGCTGAATATTCACAGAG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin

Nucleotide

• Length: 62 bp

>AT27597 NC_017659:79735-79796 [Escherichia coli O83:H1 str. NRG 857C]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Antitoxin