Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 100155..100388 | Replicon | plasmid pE57-1 |
| Accession | NZ_CP121154 | ||
| Organism | Escherichia coli strain E57 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | P6H84_RS24530 | Protein ID | WP_001372321.1 |
| Coordinates | 100155..100280 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 100357..100388 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6H84_RS24485 (95202) | 95202..95429 | - | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
| P6H84_RS24490 (95523) | 95523..96209 | - | 687 | WP_000332484.1 | PAS domain-containing protein | - |
| P6H84_RS24495 (96400) | 96400..96783 | - | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| P6H84_RS24500 (97060) | 97060..97707 | + | 648 | WP_000614936.1 | transglycosylase SLT domain-containing protein | - |
| P6H84_RS24505 (98004) | 98004..98825 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| P6H84_RS24510 (98946) | 98946..99233 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| P6H84_RS24515 (99258) | 99258..99464 | - | 207 | WP_000547939.1 | hypothetical protein | - |
| P6H84_RS24520 (99534) | 99534..99707 | + | 174 | Protein_121 | hypothetical protein | - |
| P6H84_RS24525 (99705) | 99705..99935 | - | 231 | WP_001426396.1 | hypothetical protein | - |
| P6H84_RS24530 (100155) | 100155..100280 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| P6H84_RS24535 (100222) | 100222..100371 | - | 150 | Protein_124 | plasmid maintenance protein Mok | - |
| - (100357) | 100357..100388 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (100357) | 100357..100388 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (100357) | 100357..100388 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (100357) | 100357..100388 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (101830) | 101830..102027 | - | 198 | NuclAT_0 | - | - |
| - (101830) | 101830..102027 | - | 198 | NuclAT_0 | - | - |
| - (101830) | 101830..102027 | - | 198 | NuclAT_0 | - | - |
| - (101830) | 101830..102027 | - | 198 | NuclAT_0 | - | - |
| P6H84_RS24545 (101839) | 101839..102027 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| P6H84_RS24550 (101996) | 101996..102758 | - | 763 | Protein_127 | plasmid SOS inhibition protein A | - |
| P6H84_RS24555 (102755) | 102755..103189 | - | 435 | WP_000845895.1 | conjugation system SOS inhibitor PsiB | - |
| P6H84_RS24560 (103244) | 103244..105202 | - | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / aph(3')-Ia / sul3 / ant(3'')-Ia / cmlA1 / aadA2 / blaCTX-M-27 / dfrA14 / mph(A) | - | 1..124410 | 124410 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T275947 WP_001372321.1 NZ_CP121154:c100280-100155 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 32 bp
>AT275947 NZ_CP121154:c100388-100357 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
