Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3634334..3635013 | Replicon | chromosome |
Accession | NZ_CP121153 | ||
Organism | Escherichia coli strain E57 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A0A1A1R1 |
Locus tag | P6H84_RS17695 | Protein ID | WP_000057541.1 |
Coordinates | 3634711..3635013 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | P6H84_RS17690 | Protein ID | WP_000806442.1 |
Coordinates | 3634334..3634675 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6H84_RS17680 (3630577) | 3630577..3631509 | - | 933 | WP_000883039.1 | glutaminase A | - |
P6H84_RS17685 (3631772) | 3631772..3634276 | + | 2505 | WP_061092784.1 | copper-exporting P-type ATPase CopA | - |
P6H84_RS17690 (3634334) | 3634334..3634675 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
P6H84_RS17695 (3634711) | 3634711..3635013 | - | 303 | WP_000057541.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P6H84_RS17700 (3635146) | 3635146..3635940 | + | 795 | WP_000365157.1 | TraB/GumN family protein | - |
P6H84_RS17705 (3636144) | 3636144..3636623 | + | 480 | WP_000186626.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
P6H84_RS17710 (3636660) | 3636660..3638312 | - | 1653 | WP_000771723.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
P6H84_RS17715 (3638530) | 3638530..3639750 | + | 1221 | WP_001251634.1 | fosmidomycin MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11795.37 Da Isoelectric Point: 10.2638
>T275938 WP_000057541.1 NZ_CP121153:c3635013-3634711 [Escherichia coli]
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A1A1R1 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2EBY | |
AlphaFold DB | S1QAY3 |