Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 764875..765568 | Replicon | chromosome |
Accession | NZ_CP121153 | ||
Organism | Escherichia coli strain E57 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | P6H84_RS03685 | Protein ID | WP_000415584.1 |
Coordinates | 764875..765171 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | P6H84_RS03690 | Protein ID | WP_000650107.1 |
Coordinates | 765173..765568 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6H84_RS03650 (759963) | 759963..760277 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
P6H84_RS03655 (760308) | 760308..760889 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
P6H84_RS03660 (761208) | 761208..761540 | + | 333 | WP_023149630.1 | DUF2645 family protein | - |
P6H84_RS03665 (761586) | 761586..762935 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
P6H84_RS03670 (762932) | 762932..763591 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
P6H84_RS03675 (763743) | 763743..764135 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
P6H84_RS03680 (764188) | 764188..764670 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
P6H84_RS03685 (764875) | 764875..765171 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
P6H84_RS03690 (765173) | 765173..765568 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
P6H84_RS03695 (765701) | 765701..767308 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
P6H84_RS03700 (767446) | 767446..769704 | + | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T275927 WP_000415584.1 NZ_CP121153:764875-765171 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT275927 WP_000650107.1 NZ_CP121153:765173-765568 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|