Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 5056442..5057044 | Replicon | chromosome |
Accession | NZ_CP121151 | ||
Organism | Escherichia coli strain E47 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | P6H31_RS25005 | Protein ID | WP_000897305.1 |
Coordinates | 5056733..5057044 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | P6H31_RS25000 | Protein ID | WP_000356397.1 |
Coordinates | 5056442..5056732 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6H31_RS24975 (5052367) | 5052367..5053269 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
P6H31_RS24980 (5053266) | 5053266..5053901 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
P6H31_RS24985 (5053898) | 5053898..5054827 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
P6H31_RS24990 (5055157) | 5055157..5055399 | - | 243 | WP_001087409.1 | protein YiiF | - |
P6H31_RS24995 (5055619) | 5055619..5055837 | - | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
P6H31_RS25000 (5056442) | 5056442..5056732 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
P6H31_RS25005 (5056733) | 5056733..5057044 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
P6H31_RS25010 (5057273) | 5057273..5058181 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
P6H31_RS25015 (5058245) | 5058245..5059186 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
P6H31_RS25020 (5059231) | 5059231..5059668 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
P6H31_RS25025 (5059665) | 5059665..5060537 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
P6H31_RS25030 (5060531) | 5060531..5061130 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
P6H31_RS25035 (5061229) | 5061229..5062014 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T275918 WP_000897305.1 NZ_CP121151:c5057044-5056733 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|