Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 3042545..3042765 Replicon chromosome
Accession NZ_CP121151
Organism Escherichia coli strain E47

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag P6H31_RS15200 Protein ID WP_000170965.1
Coordinates 3042658..3042765 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 3042545..3042611 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P6H31_RS15175 3037824..3039218 - 1395 WP_000086201.1 inverse autotransporter invasin YchO -
P6H31_RS15180 3039403..3039756 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
P6H31_RS15185 3039800..3040495 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
P6H31_RS15190 3040653..3040883 - 231 WP_001146442.1 putative cation transport regulator ChaB -
P6H31_RS15195 3041153..3042253 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 3042545..3042611 - 67 - - Antitoxin
P6H31_RS15200 3042658..3042765 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 3043078..3043141 - 64 NuclAT_34 - -
- 3043078..3043141 - 64 NuclAT_34 - -
- 3043078..3043141 - 64 NuclAT_34 - -
- 3043078..3043141 - 64 NuclAT_34 - -
- 3043078..3043141 - 64 NuclAT_37 - -
- 3043078..3043141 - 64 NuclAT_37 - -
- 3043078..3043141 - 64 NuclAT_37 - -
- 3043078..3043141 - 64 NuclAT_37 - -
- 3043078..3043141 - 64 NuclAT_40 - -
- 3043078..3043141 - 64 NuclAT_40 - -
- 3043078..3043141 - 64 NuclAT_40 - -
- 3043078..3043141 - 64 NuclAT_40 - -
- 3043078..3043141 - 64 NuclAT_43 - -
- 3043078..3043141 - 64 NuclAT_43 - -
- 3043078..3043141 - 64 NuclAT_43 - -
- 3043078..3043141 - 64 NuclAT_43 - -
- 3043078..3043141 - 64 NuclAT_46 - -
- 3043078..3043141 - 64 NuclAT_46 - -
- 3043078..3043141 - 64 NuclAT_46 - -
- 3043078..3043141 - 64 NuclAT_46 - -
- 3043078..3043141 - 64 NuclAT_49 - -
- 3043078..3043141 - 64 NuclAT_49 - -
- 3043078..3043141 - 64 NuclAT_49 - -
- 3043078..3043141 - 64 NuclAT_49 - -
- 3043079..3043141 - 63 NuclAT_51 - -
- 3043079..3043141 - 63 NuclAT_51 - -
- 3043079..3043141 - 63 NuclAT_51 - -
- 3043079..3043141 - 63 NuclAT_51 - -
- 3043079..3043141 - 63 NuclAT_54 - -
- 3043079..3043141 - 63 NuclAT_54 - -
- 3043079..3043141 - 63 NuclAT_54 - -
- 3043079..3043141 - 63 NuclAT_54 - -
- 3043079..3043141 - 63 NuclAT_57 - -
- 3043079..3043141 - 63 NuclAT_57 - -
- 3043079..3043141 - 63 NuclAT_57 - -
- 3043079..3043141 - 63 NuclAT_57 - -
- 3043080..3043141 - 62 NuclAT_16 - -
- 3043080..3043141 - 62 NuclAT_16 - -
- 3043080..3043141 - 62 NuclAT_16 - -
- 3043080..3043141 - 62 NuclAT_16 - -
- 3043080..3043141 - 62 NuclAT_19 - -
- 3043080..3043141 - 62 NuclAT_19 - -
- 3043080..3043141 - 62 NuclAT_19 - -
- 3043080..3043141 - 62 NuclAT_19 - -
- 3043080..3043141 - 62 NuclAT_22 - -
- 3043080..3043141 - 62 NuclAT_22 - -
- 3043080..3043141 - 62 NuclAT_22 - -
- 3043080..3043141 - 62 NuclAT_22 - -
- 3043080..3043141 - 62 NuclAT_25 - -
- 3043080..3043141 - 62 NuclAT_25 - -
- 3043080..3043141 - 62 NuclAT_25 - -
- 3043080..3043141 - 62 NuclAT_25 - -
- 3043080..3043141 - 62 NuclAT_28 - -
- 3043080..3043141 - 62 NuclAT_28 - -
- 3043080..3043141 - 62 NuclAT_28 - -
- 3043080..3043141 - 62 NuclAT_28 - -
- 3043080..3043141 - 62 NuclAT_31 - -
- 3043080..3043141 - 62 NuclAT_31 - -
- 3043080..3043141 - 62 NuclAT_31 - -
- 3043080..3043141 - 62 NuclAT_31 - -
P6H31_RS15205 3043194..3043301 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 3043614..3043679 - 66 NuclAT_33 - -
- 3043614..3043679 - 66 NuclAT_33 - -
- 3043614..3043679 - 66 NuclAT_33 - -
- 3043614..3043679 - 66 NuclAT_33 - -
- 3043614..3043679 - 66 NuclAT_36 - -
- 3043614..3043679 - 66 NuclAT_36 - -
- 3043614..3043679 - 66 NuclAT_36 - -
- 3043614..3043679 - 66 NuclAT_36 - -
- 3043614..3043679 - 66 NuclAT_39 - -
- 3043614..3043679 - 66 NuclAT_39 - -
- 3043614..3043679 - 66 NuclAT_39 - -
- 3043614..3043679 - 66 NuclAT_39 - -
- 3043614..3043679 - 66 NuclAT_42 - -
- 3043614..3043679 - 66 NuclAT_42 - -
- 3043614..3043679 - 66 NuclAT_42 - -
- 3043614..3043679 - 66 NuclAT_42 - -
- 3043614..3043679 - 66 NuclAT_45 - -
- 3043614..3043679 - 66 NuclAT_45 - -
- 3043614..3043679 - 66 NuclAT_45 - -
- 3043614..3043679 - 66 NuclAT_45 - -
- 3043614..3043679 - 66 NuclAT_48 - -
- 3043614..3043679 - 66 NuclAT_48 - -
- 3043614..3043679 - 66 NuclAT_48 - -
- 3043614..3043679 - 66 NuclAT_48 - -
- 3043615..3043681 - 67 NuclAT_50 - -
- 3043615..3043681 - 67 NuclAT_50 - -
- 3043615..3043681 - 67 NuclAT_50 - -
- 3043615..3043681 - 67 NuclAT_50 - -
- 3043615..3043681 - 67 NuclAT_53 - -
- 3043615..3043681 - 67 NuclAT_53 - -
- 3043615..3043681 - 67 NuclAT_53 - -
- 3043615..3043681 - 67 NuclAT_53 - -
- 3043615..3043681 - 67 NuclAT_56 - -
- 3043615..3043681 - 67 NuclAT_56 - -
- 3043615..3043681 - 67 NuclAT_56 - -
- 3043615..3043681 - 67 NuclAT_56 - -
- 3043616..3043679 - 64 NuclAT_15 - -
- 3043616..3043679 - 64 NuclAT_15 - -
- 3043616..3043679 - 64 NuclAT_15 - -
- 3043616..3043679 - 64 NuclAT_15 - -
- 3043616..3043679 - 64 NuclAT_18 - -
- 3043616..3043679 - 64 NuclAT_18 - -
- 3043616..3043679 - 64 NuclAT_18 - -
- 3043616..3043679 - 64 NuclAT_18 - -
- 3043616..3043679 - 64 NuclAT_21 - -
- 3043616..3043679 - 64 NuclAT_21 - -
- 3043616..3043679 - 64 NuclAT_21 - -
- 3043616..3043679 - 64 NuclAT_21 - -
- 3043616..3043679 - 64 NuclAT_24 - -
- 3043616..3043679 - 64 NuclAT_24 - -
- 3043616..3043679 - 64 NuclAT_24 - -
- 3043616..3043679 - 64 NuclAT_24 - -
- 3043616..3043679 - 64 NuclAT_27 - -
- 3043616..3043679 - 64 NuclAT_27 - -
- 3043616..3043679 - 64 NuclAT_27 - -
- 3043616..3043679 - 64 NuclAT_27 - -
- 3043616..3043679 - 64 NuclAT_30 - -
- 3043616..3043679 - 64 NuclAT_30 - -
- 3043616..3043679 - 64 NuclAT_30 - -
- 3043616..3043679 - 64 NuclAT_30 - -
P6H31_RS15210 3043729..3043836 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
P6H31_RS15215 3043985..3044839 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
P6H31_RS15220 3044875..3045684 - 810 WP_001257044.1 invasion regulator SirB1 -
P6H31_RS15225 3045688..3046080 - 393 WP_000200392.1 invasion regulator SirB2 -
P6H31_RS15230 3046077..3046910 - 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T275911 WP_000170965.1 NZ_CP121151:3042658-3042765 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT275911 NZ_CP121151:c3042611-3042545 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References