Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4789558..4790160 | Replicon | chromosome |
Accession | NZ_CP121149 | ||
Organism | Escherichia coli strain E14 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | P1I99_RS23210 | Protein ID | WP_001593848.1 |
Coordinates | 4789849..4790160 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | P1I99_RS23205 | Protein ID | WP_000356397.1 |
Coordinates | 4789558..4789848 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1I99_RS23180 (4785503) | 4785503..4786405 | + | 903 | WP_169759669.1 | formate dehydrogenase O subunit beta | - |
P1I99_RS23185 (4786402) | 4786402..4787037 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
P1I99_RS23190 (4787034) | 4787034..4787963 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
P1I99_RS23195 (4788293) | 4788293..4788535 | - | 243 | WP_001087409.1 | protein YiiF | - |
P1I99_RS23200 (4788754) | 4788754..4788972 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
P1I99_RS23205 (4789558) | 4789558..4789848 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
P1I99_RS23210 (4789849) | 4789849..4790160 | - | 312 | WP_001593848.1 | hypothetical protein | Toxin |
P1I99_RS23215 (4790389) | 4790389..4791282 | + | 894 | WP_276169778.1 | alpha/beta hydrolase | - |
P1I99_RS23220 (4791361) | 4791361..4792302 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
P1I99_RS23225 (4792347) | 4792347..4792784 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
P1I99_RS23230 (4792781) | 4792781..4793653 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
P1I99_RS23235 (4793647) | 4793647..4794246 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12174.15 Da Isoelectric Point: 9.7791
>T275895 WP_001593848.1 NZ_CP121149:c4790160-4789849 [Escherichia coli]
MLFIETEIFTEDVQKPLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKPLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|