Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 31309..31542 | Replicon | plasmid pE20-1 |
| Accession | NZ_CP121148 | ||
| Organism | Escherichia coli strain E20 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | P6H07_RS23945 | Protein ID | WP_001372321.1 |
| Coordinates | 31309..31434 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 31511..31542 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6H07_RS23900 (26356) | 26356..26583 | - | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
| P6H07_RS23905 (26677) | 26677..27363 | - | 687 | WP_000332484.1 | PAS domain-containing protein | - |
| P6H07_RS23910 (27554) | 27554..27937 | - | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| P6H07_RS23915 (28214) | 28214..28861 | + | 648 | WP_000614936.1 | transglycosylase SLT domain-containing protein | - |
| P6H07_RS23920 (29158) | 29158..29979 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| P6H07_RS23925 (30100) | 30100..30387 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| P6H07_RS23930 (30412) | 30412..30618 | - | 207 | WP_000547939.1 | hypothetical protein | - |
| P6H07_RS23935 (30688) | 30688..30861 | + | 174 | Protein_39 | hypothetical protein | - |
| P6H07_RS23940 (30859) | 30859..31089 | - | 231 | WP_001426396.1 | hypothetical protein | - |
| P6H07_RS23945 (31309) | 31309..31434 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| P6H07_RS23950 (31376) | 31376..31525 | - | 150 | Protein_42 | plasmid maintenance protein Mok | - |
| - (31511) | 31511..31542 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (31511) | 31511..31542 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (31511) | 31511..31542 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (31511) | 31511..31542 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (32984) | 32984..33181 | - | 198 | NuclAT_0 | - | - |
| - (32984) | 32984..33181 | - | 198 | NuclAT_0 | - | - |
| - (32984) | 32984..33181 | - | 198 | NuclAT_0 | - | - |
| - (32984) | 32984..33181 | - | 198 | NuclAT_0 | - | - |
| P6H07_RS23960 (32993) | 32993..33181 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| P6H07_RS23965 (33150) | 33150..33912 | - | 763 | Protein_45 | plasmid SOS inhibition protein A | - |
| P6H07_RS23970 (33909) | 33909..34343 | - | 435 | WP_000845895.1 | conjugation system SOS inhibitor PsiB | - |
| P6H07_RS23975 (34398) | 34398..36356 | - | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | mph(A) / tet(A) / aph(3')-Ia / sul3 / ant(3'')-Ia / cmlA1 / aadA2 / blaCTX-M-27 / dfrA14 | - | 1..124410 | 124410 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T275873 WP_001372321.1 NZ_CP121148:c31434-31309 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 32 bp
>AT275873 NZ_CP121148:c31542-31511 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
